Science method
Regularization - Science method
Explore the latest questions and answers in Regularization, and find Regularization experts.
Questions related to Regularization
But, by and large, coitus in marriage occurs with a regularity which is not equalled by any other type of sexual activity in the female, although it may be matched by the masturbatory, coital, and sometimes homosexual activity of the male. This suggests that it is the male rather than the female partner who is chiefly responsible for the regularity of marital coitus. (Alfred Kinsey)
We are setting up PingFederate in GCP env using devops. The vanilla Ping authentication works without issues.
However, helm charts of Pingfederate does not have annotations / variables to configure x509 on same end-point as regular authentication.
Cyber security incident response refers to the process of responding to and managing a cyber security incident, such as a data breach, malware outbreak, or denial-of-service (DoS) attack. The goal of incident response is to quickly and effectively contain and mitigate the incident, minimize damage, and restore normal operations.
*Incident Response Phases:*
1. *Preparation*: Develop an incident response plan, establish an incident response team, and conduct regular training and exercises.
2. *Detection*: Identify and detect potential security incidents through monitoring, logging, and alerting.
3. *Containment*: Take immediate action to contain the incident and prevent further damage.
4. *Eradication*: Remove the root cause of the incident and restore systems to a known good state.
5. *Recovery*: Restore normal operations and ensure that systems are functioning as expected.
6. *Post-Incident Activities*: Conduct a post-incident review, identify lessons learned, and implement changes to prevent similar incidents in the future.
*Key Incident Response Activities:*
1. *Incident Classification*: Determine the type and severity of the incident.
2. *Incident Reporting*: Notify relevant stakeholders, including management, customers, and regulatory bodies.
3. *Forensic Analysis*: Collect and analyze evidence to determine the root cause of the incident.
4. *Communication*: Coordinate with stakeholders, including law enforcement, vendors, and customers.
5. *Incident Documentation*: Maintain detailed records of the incident, including timelines, actions taken, and lessons learned.
*Incident Response Team Roles:*
1. *Incident Response Manager*: Oversees the incident response process and coordinates the response effort.
2. *Security Analyst*: Conducts forensic analysis and provides technical expertise.
3. *Communications Specialist*: Handles communication with stakeholders and the media.
4. *Technical Specialist*: Provides technical support and assistance with containment and eradication efforts.
*Best Practices:*
1. *Develop a Comprehensive Incident Response Plan*: Establish a plan that outlines roles, responsibilities, and procedures.
2. *Conduct Regular Training and Exercises*: Ensure that the incident response team is prepared and trained to respond to incidents.
3. *Implement Incident Response Tools and Technologies*: Utilize tools and technologies, such as incident response platforms and threat intelligence feeds, to support incident response efforts.
4. *Continuously Monitor and Improve*: Regularly review and update the incident response plan and procedures to ensure they remain effective and relevant.
Hi, I am using a regularized XGBoost model. I have included industry and location dummies. The ML model, via regularization, is excluding a few city dummies and a few industry dummies, declaring them statistically insignificant contributors in the prediction.
Is there any literature that we cannot remove a few such dummies just based on the mathematics behind the regularization? We should have strong logic, says one of my labmates.
My personal opinion is that it should be just fine because we need significant predictors for feature selection purposes. Therefore, it should not have any side effects as we have in econometric modeling.
Any constructive suggestions are welcome from domain experts.
Regards,
Sahil
I am interested in studying the historical transformation of small buildings (less than 30 meters). However, I have encountered limitations with Google Earth, as it does not provide satellite images for the specific region at regular intervals of time, and the available images do not date back earlier than 2010. Despite this, I aim to analyze the changes in the targeted small buildings at regular intervals from the year 2000 onward, specifically for the years 2000, 2005, 2010, 2015, and 2020.
Thank you in advance for your assistance.
The Earth is a very big place, and there are hundreds of orbital sensors, platforms, etc. along with hundreds of various agency and commercial data portals so knowing the spatial extents of your area of interest and some idea of the sort of useful granular resolution would be useful.
( photos are Norilsk, USSR, circa 1960-1980 , estimated 30 centimeter resolution )
I want to generate a surface elevation vs time plot in CFD post.
I am using first order airy wave theory to generate regular waves.
But I am not able to generate the plot of regular waves, all waves are having different amplitudes.
There is not barrier or structure just wave tank only
I am using user defined expression for surface elevation lengthInt(water.volume.fraction)@line1
Creating a comprehensive mental health policy for academicians is essential to ensure the well-being and productivity of those in the academic community. Academic life can be highly demanding and stressful, leading to burnout, anxiety, and other mental health issues.
Here are some key components that should be considered when developing a mental health policy for academicians:
- Awareness and Education: Implement programs to raise awareness about mental health issues and reduce the stigma surrounding seeking help. Workshops and training sessions can be organized to educate academicians about stress management, coping mechanisms, and the signs of mental health problems.
- Access to Mental Health Services: Ensure that mental health services are easily accessible to all academicians. This can include on-campus counseling centers, confidential hotlines, or partnerships with local mental health providers. Teletherapy options can also be explored to facilitate access to mental health support.
- Confidentiality and Privacy: Emphasize the importance of confidentiality and privacy when seeking mental health assistance. Academicians should feel safe and secure when reaching out for help without fear of any negative repercussions.
- Work-Life Balance: Encourage a healthy work-life balance by promoting flexible working hours, remote work options, and the availability of paid time off. Overworking and constant pressure can contribute to mental health issues, so it's crucial to create an environment that supports a balance between work and personal life.
- Stress Management and Resilience: Integrate stress management and resilience-building programs into the academic curriculum or professional development initiatives. These can include mindfulness training, relaxation techniques, and workshops on maintaining mental well-being during challenging times.
- Supportive Academic Environment: Foster a supportive and understanding academic culture. Encourage open communication and support networks among colleagues and supervisors. Promote a culture of empathy and empathy within the institution.
- Mental Health Assessment and Monitoring: Implement regular mental health assessments to identify individuals at risk and provide early intervention. Utilize surveys or other screening tools to gauge the mental well-being of academicians.
- Mental Health Days: Recognize the importance of mental health by providing mental health days as part of the sick leave policy. This allows academicians to take time off when they are struggling emotionally or mentally without feeling guilty.
- Collaboration with External Resources: Collaborate with mental health organizations, non-profits, and government agencies to develop a comprehensive mental health support system. Leverage external resources to enhance the institution's mental health offerings.
- Research and Data Collection: Encourage research on mental health issues in academia to better understand the challenges faced by academicians and the effectiveness of implemented policies. Use data to continually improve and adapt the mental health policy as needed.
- Crisis Management Plan: Develop a crisis management plan to address critical incidents that may impact the mental health of the academic community. This plan should outline the steps to be taken in response to emergencies and how to provide immediate support.
- Leadership Support: Obtain buy-in and active support from the institution's leadership. Leaders can set the tone for prioritizing mental health by actively promoting the policy and leading by example.
Implementing a mental health policy for academicians requires collaboration among various stakeholders, including administrators, faculty, staff, and students. Regular reviews and updates are essential to ensure the policy remains effective and relevant to the evolving needs of the academic community.
I looked at posts from 2014 through 2022 on this topic and it is all obsolete. Bacharach's fyrite analyzers have been discontinued, I don't have time or equipment for measuring minute pH changes in the incubator water, and the links are all dead. (i.e. Please do not link back to old posts.) I see many modern CO2 analyzers, but they do not look compatible with an incubator sample port. Does anyone have a 2024 updated method for measuring CO2 in an older mammalian cell culture incubator that requires regular calibration?
With my husband, I sometimes feel obligated because I’m his wife and, after all, he does pay for everything. (Shere Hite)
Hi everyone,
I have a problem involving a Fredholm equation of the first kind, and I need to apply Tikhonov regularization to solve it.
Is the method L-BFGS-B algorithm in python good
Regards,
Abdelmalek
Has anyone used Lupex Biotechnology Protein ladder (P101-2, 9-180 kDa) in gels? Do you get good separated bands? Please do share images too, if so. Thank You.
The difference between a regular antenna and a reconfigurable antenna
How to make buildings resistant to earthquakes?
Now in Iran, according to my suggestion, Unilit roof is used in the roofs of residential and office buildings, which is very light. I took this suggestion in an article for the seismological organization in Tehran and gave 14 suggestions to prevent the Tehran earthquake, including 2 They implemented it. One of them removed the bricks from the roof of residential and office buildings and put unilite and poured concrete on top of it, which is very resistant because there is a round rod inside the bits and it was mixed with concrete, and I also said that in metal buildings from 7 or 8 should be used next to the walls because it makes the Masguni houses stronger and also 2 parking spaces should be used under the buildings, like palm trees or dates, which have deep roots and will not fall during an earthquake. Buildings must have deep roots and also in the science of retrofitting structures, divergence is used, that is, natural or artificial rubber is used under the pillars of the houses, and steel springs are used in the middle, so that during an earthquake, the building, like a car or A car that has a spring and the springs play, the building goes up and down but does not fall, and this is a building engineering science that makes buildings resistant to earthquakes and natural disasters. And secondly, through the injection of water and salt solution, the energy of the faults can be removed. Because it comes from the earth's core, which has 6000 degrees Celsius of heat. At any moment, this heat transfers to the surface of the earth. Therefore, the energy inside the earth must be removed, and by transferring the water and salt solution that all the oil extraction companies have, which is known as the injection of water and salt solution, like a tiny needle that is inserted into a balloon so that the balloon does not burst, we humans can create an artificial earthquake. Let's prevent the earthquake explosion and create an artificial earthquake ourselves and release the pressure inside the earth. And 3, we should not build residential or office buildings where there is a fault line, because the buildings are heavy and the taller and bigger they are, the more pressure is placed on the faults. So either we have to build a single floor or not at all to prevent an earthquake from happening.
Wisam Fawzi added an answer
I saw that this technique is used in most Iranian structures and my personal opinion is a successful technique.
László Attila Horváth added a reply
Did you used technics of Ioannis Lymperis ?
László Attila Horváth added a reply
Did you used technics of Ioannis Lymperis ?
Ioannis Lymperis added a reply
The Ultimate Anti-Seismic Design Method
The design mechanisms and methods of the invention are intended to minimize problems related to the safety of structures in the event of natural phenomena such as earthquakes, tornadoes, and strong winds. It is achieved by controlling the deformations of the structure. Damage and deformation are closely related concepts since the control of deformations also controls the damage. The design method of applying artificial compression to the ends of all longitudinal reinforced concrete walls and, at the same time, connecting the ends of the walls to the ground using ground anchors placed at the depths of the boreholes, transfers the inertial stresses of the structure in the ground, which reacts as an external force in the structure’s response to seismic displacements. The wall with the artificial compression acquires dynamic, larger active cross-section and high axial and torsional stiffness, preventing all failures caused by inelastic deformation. By connecting the ends of all walls to the ground, we control the eigenfrequency of the structure and the ground during each seismic loading cycle, preventing inelastic displacements. At the same time, we ensure the strong bearing capacity of the foundation soil and the structure. By designing the walls correctly and placing them in proper locations, we prevent the torsional flexural buckling that occurs in asymmetrical floor plans, and metal and tall structures. Compression of the wall sections at the ends and their anchoring to the ground mitigates the transfer of deformations to the connection nodes, strengthens the wall section in terms of base shear force and shear stress of the sections, and increases the strength of the cross-sections to the tensile at the ends of the walls by introducing counteractive forces. The use of tendons within the ducts prevents longitudinal shear in the overlay concrete, while anchoring the walls to the foundation not only dissipates inertial forces to the ground but also prevents rotation of the walls, thus maintaining the structural integrity of the beams. The prestressing at the bilateral ends of the walls restores the structure to its original position even inelastic displacements by closing the opening of the developing cracks.
Article The Ultimate Anti-Seismic Design Method
Reply to this discussion
Roots
Injections
Damage
Eigenfrequency
Foundations
Following
Share
All replies (3)
📷
Miguel Angel Morales added a reply
July 9
There are two ways to achieve it. To start, we can make buildings more ductile, that is, they can withstand stronger deformations without failing; On the other hand, we can design more rigid structures, which implies that the buildings resist greater accelerations.
These systems consist of elements for energy dissipation or assimilation. The first type of system seeks to increase the capacity to "lose" energy, such as the "Saint Andrew's Cross" trusses, and others work as seismic dampers or isolators.
Recommend
Share
📷
Khawaja Muhammad Iftikhar added a reply
July 25
Abbas Kashani
Miguel Angel Morales
To make buildings resistant to earthquakes, it is essential to incorporate various engineering principles and design practices. Here are the key steps and considerations in detail:
1. Site Selection and Soil Analysis
- Site Selection: Choose a site with stable ground, avoiding areas prone to liquefaction, landslides, or fault lines.
- Geotechnical Analysis: Conduct thorough soil investigations to understand the soil properties and behavior under seismic loads. This includes soil borings, lab tests, and evaluating soil-structure interaction.
2. Building Design
- Seismic Codes and Standards: Adhere to local and international building codes (e.g., IBC, Eurocode, IS Codes) that specify seismic design requirements.
- Structural Configuration: Opt for simple, regular, and symmetric building shapes to ensure even distribution of seismic forces.
- Redundancy and Robustness: Design for multiple load paths so that if one path fails, others can carry the load.
- Foundation Design: Use deep foundations like piles or caissons in soft soils to reach stable strata. Consider mat foundations for better distribution of seismic forces.
3. Structural Elements
- Base Isolation: Install base isolators to decouple the building from ground motion, reducing seismic forces transmitted to the structure.
- Energy Dissipation Devices: Use dampers (viscous, friction, or tuned mass dampers) to absorb and dissipate seismic energy.
- Flexible Joints: Incorporate expansion joints to allow sections of the building to move independently, reducing stress concentrations.
- Shear Walls and Bracing: Use reinforced concrete shear walls or steel bracing systems to resist lateral forces.
- Moment-Resisting Frames: Design frames that can withstand bending moments and shear forces during an earthquake.
4. Materials and Construction Quality
- High-Quality Materials: Use materials with appropriate strength, ductility, and durability. Reinforced concrete, structural steel, and composite materials are commonly used.
- Reinforcement Detailing: Ensure proper detailing of reinforcement bars in concrete to prevent brittle failure and enhance ductility.
- Construction Practices: Follow best practices and quality control during construction to avoid defects and ensure the building performs as designed.
5. Retrofitting Existing Buildings
- Seismic Assessment: Evaluate the seismic vulnerability of existing buildings using detailed analysis and field surveys.
- Strengthening Techniques: Employ techniques such as adding shear walls, bracing, jacketing columns, and using fiber-reinforced polymers to enhance the seismic resistance of existing structures.
6. Innovation and Technology
- Advanced Simulation Tools: Use computer modeling and simulation tools to predict building behavior under seismic loads and optimize designs.
- Smart Materials: Incorporate materials with adaptive properties, such as shape memory alloys, which can absorb and dissipate energy efficiently.
7. Community and Lifeline Considerations
- Building Codes Enforcement: Ensure strict enforcement of building codes and regulations.
- Public Awareness: Educate the public and stakeholders about the importance of seismic-resistant design and construction.
- Lifeline Infrastructure: Design critical infrastructure (e.g., hospitals, emergency response centers) to higher seismic standards to ensure functionality after an earthquake.
By integrating these principles and practices, engineers can significantly enhance the earthquake resistance of buildings, thereby reducing the risk of damage and loss of life during seismic events.
Recommend
Share
- 1 Recommendation
📷
Sebastian Schmitt added a reply
20 minutes ago
Khawaja Muhammad Iftikhar, do you really think that a random, AI-generated answer is helpful for Abbas?
…
Let's say we have a standard, regular hexagonal honeycomb with a 3-arm primitive unit cell (something like the figure attached; the figure is only representative and not drawn to scale). The bottommost node is taken as the source of wave input and the ends of the left and right arms are taken as destinations such that Bloch's condition can be applied as qleft = eik1 qbottom and qright = eik2 qbottom. I wish to learn how would an iso-frequency contour plot be plotted post performing the dispersion analysis. Thanks in advance.
For First and practice samples or workshops for students
* Reducing the incidence of preclinical nephropathy in patients with type II diabetes and diabetic retinopathy involves comprehensive management strategies, including:
Blood Glucose Control: Tight glycemic control through lifestyle modifications, oral medications, or insulin therapy can slow the progression of nephropathy.
Blood Pressure Management: Controlling hypertension through medications, dietary changes, and lifestyle modifications is crucial in preventing kidney damage.
Renin-Angiotensin-Aldosterone System (RAAS) Inhibitors: Medications like ACE inhibitors or angiotensin II receptor blockers (ARBs) have shown to be effective in slowing the progression of diabetic nephropathy.
Lipid Management: Managing dyslipidemia with statins or other lipid-lowering agents may help reduce the risk of nephropathy progression.
Protein Restriction: Dietary protein restriction may be recommended to reduce the workload on the kidneys and slow the progression of nephropathy.
Regular Monitoring: Routine monitoring of kidney function through urine albumin excretion, serum creatinine, and estimated glomerular filtration rate (eGFR) can help detect early signs of nephropathy and guide treatment.
Lifestyle Modifications: Encouraging healthy lifestyle habits such as regular exercise, smoking cessation, and maintaining a healthy weight can contribute to overall kidney health.
Annual Eye Examinations: Regular eye exams can detect diabetic retinopathy early, allowing for prompt treatment and potentially preventing further kidney complications.
Education and Support: Providing patients with education about diabetes management, including the importance of medication adherence, regular check-ups, and lifestyle modifications, can empower them to take control of their health and reduce the risk of complications.
Multidisciplinary Care: Collaborative care involving endocrinologists, nephrologists, ophthalmologists, dietitians, and other healthcare professionals can provide comprehensive support for patients with diabetes and diabetic complications.
Cellular networks have a reputation for being expensive for constant data transfer. How do CIoT service plans typically differ from regular phone plans to accommodate the low-power, low-data needs of IoT devices?
in the given regular triangle ABC find the locus of the points M inside this triangle such that MAB +MBC+MCA=pi/2
Does anyone have any idea about the page limit for regular papers in FGCS? Couldn't find any information from the author's guidelines. Thanks in advance.
The numerical solution of the singular integral equations has been developed by Erdogan and many other researchers (e.g., Erdogan, F., Gupta, G.D., 1972. On the numerical solution of singular integral equations. Q. Appl. Math. 29, 525–534. DOI: ), where the Gauss-Chebyshev quadrature method was proposed. However, if the kernel function of the integral is already regular, then may I ask what is the proper numerical method to deal with this issue?
A necessary condition to utilize Erdogan's method is that the coefficients a_ij (please refer to the picture in the file) of the singular term are non-singular, which is not the case I would want to deal with, since those coefficients are already zero in the regular integral equations.
I would be very grateful if you can give me some guidence! Thank you very much!
I get regular notices from you that I am the second most read person at my institution, and I am curious regarding who is the mos read person. So far I can't make the search work to find out.
Thanks.
I know teachers are growing in their professionalism but allowing students in a class where the teacher do not have the capacity on the required attention and quality of a SPED will be a conflict on every classes and teachers into.
I would like to carry out the study on consumption pattern of a particular fruit in a specified areas. In what form they utilize the fruit in the regular meals and how frequently they use in their regular meals.
Please suggest type of questionnaire and how to carry out the study, selection of population, no. of population etc
Yesterday, I shared the link to this article with several other RG members, and some of us have posted comments there. But I think it might be a lot easier to continue the discussion here (in a regular discussion thread) than it is via the Comments section there.
Here is the link to the article:
Cheers,
Bruce
For individuals with diabetes, maintaining joint health and mobility is crucial for overall well-being. Firstly, adopting a regular exercise routine that includes low-impact activities like walking, swimming, or cycling can enhance joint flexibility and reduce stiffness. Incorporating strength training exercises, focusing on major muscle groups, can also provide stability to joints. Controlling blood sugar levels is paramount, as elevated levels can contribute to inflammation and joint problems. A well-balanced diet rich in anti-inflammatory foods, such as fatty fish, nuts, and colorful fruits and vegetables, supports joint health. Adequate hydration is essential for joint lubrication. Regular monitoring of foot health, a common concern for diabetics, is vital to prevent complications. Additionally, consulting with healthcare professionals for personalized advice and incorporating stress management techniques can contribute to holistic joint health for individuals managing diabetes.
The frequency and duration of exercise play pivotal roles in enhancing mental health. Scientific evidence consistently reveals a positive correlation between regular physical activity and improved mental well-being. Engaging in exercise releases endorphins, reducing stress and anxiety while boosting mood. The frequency of exercise establishes a cumulative effect, contributing to long-term mental resilience. Additionally, prolonged sessions enable greater physiological adaptations, such as increased neuroplasticity and neurogenesis, further supporting cognitive function and emotional stability. Striking a balance in frequency and duration tailored to individual needs fosters a sustainable approach, harnessing the profound mental health benefits of regular exercise.
I was growing a chemical tolerant bacteria(Xanthomonas) on Nutrient agar vs Nutrient agar amended with copper. The bacteria is growing as its supposed to be on NACopper but very few or no growth on NA only. The bacteria is always maintained on media amended with copper. The chemical tolerance is not plasmid borne, so I was keeping out the plasmid addiction from my first guess.
I wanted to know that the sunflower oil which is used as a vehicle of Rotenone in Rotenone induced PD model is of some analytical grade from some company or the the regular one which is available in the market?
¿Conoces que está pasando en el mundo, más pernicioso en los jóvenes, con el consumo de cannabis, posterior a la decision de la ONU a propuesta de la OMS de regularizar la utilización del cannabis con fines de investigación cientifica a finales de 2020? Es importante escuchar los criterios, de cualquier índole, de todos nuestros científicos.
Do you know what is happening in the world, more pernicious in young people, with the consumption of cannabis, after the decision of the UN at the proposal of the WHO to regularize the use of cannabis for scientific research purposes at the end of 2020? It is important to listen to the criteria, of any kind, of all our scientists.
It is said that community based-studies are required to identify the societal risk factors such as age, sex, occupation and number of donation that are significantly associated with TTI despite of the strict screening and testing practice. The question in mind is - are there any ways to detect early on the blood donors who are at a high risk of having TTI compared to those blood donors who have regular type of blood in order to help in reducing the burden of TTI in blood banking?
Reference: Shiferaw, E., Tadilo, W., Melkie, I., & Shiferaw, M. (2019). Sero-prevalence and trends of transfusion-transmissible infections among blood donors at Bahir Dar district blood bank, northwest Ethiopia: A four year retrospective study. PLOS ONE, 14(4), e0214755. https://doi.org/10.1371/journal.pone.0214755
For a regular Low Temperature Striling Engine, how much mechanical energy can I produce by using hot water at around 350K?
I am optimizing complexes and used the following as parameters #P B3LYP/6-31G* Opt Freq Pop=(Regular,NBORead) Density=Current. How I can find HOMO LUMOs in .log file from Gaussian?
Regularization techniques like L1 and L2 help control model complexity by adding penalty terms to the loss function. This prevents overfitting, where the model memorizes noise in the data rather than capturing general patterns.
Could anyone help me with the code for interpolating stations' daily time series datasets to regular grids in Rstudio or Python?
Yes, It may be a consequence of the statistical regularity condition in the B-matrix chains which predicts a diffusion coefficient α(3D)=9/4 * α(2D)
ref: Researchgate, theory and design of audio rooms.
Is there any regularity in the solubility of electrolyte salts in polymer gels? Taking polyvinyl alcohol (PVA) as an example, LiCl can be well dissolved in PVA, followed by NaCl, and KCl is very difficult to dissolve in PVA. In this way, the solubility of salt seems to be related to metal cations, but KOH can be very well dissolved in PVA. ZnCL2 can be well dissolved in polyPVA, but ZnSO4 is very difficult. However, H2SO4 itself is very easy to dissolve in PVA solution.
Thanks.
I have heard that it is better to show PCR gene expression results via log 2 fold change rather than just fold change, but how does one calculate the confidence intervals (error bars) for that?
For log 2 fold change is it just delta delta Ct +/- 1.96*SD?
And the standard deviation for delta delta Ct = standard deviation for delta Ct??
For the regular fold change is the confidence interval just 2^-(ddCt +/- sd)? Would that mean it is a 68% confidence interval?
In the case of standing in public and attempting to stop passers-by to complete a short questionnaire, what is your basic approach? In a previous life, I was a commission salesman, so I know how important it is to make the first utterance out of your mouth the right one if you want people to give you even two seconds of their time, so what tends to work best for collecting data for research? A yes-no question? An open-ended question? A statement about the weather? Asking if they have a couple minutes vs avoiding mentioning time? Here have been some of my attempts, but it's hard to gauge which works best with the few attempts I've made:
- Excuse me, do you have a moment to talk (about ...)?
- Excuse me, what do you think about ...?
- How's it going? Hot today, isn't it?
- Hi, can you spare three minutes for ...?
(For specifics on my current survey, it's a bunch of Likert scale questions aimed at getting opinions about bilingual signage in a small town. I'm standing in front of grocery stores to encounter people as there really aren't any other places with regular foot traffic.)
I fabricated mixture of metal oxide nanocomposite and converted it to pellets to study the attenuation for gamma ray
I have a question that i would like to ask you.
I was working on a protein, Tau441, purification project. At the end I wanted to measure the concentration of the purified protein. I used SpectraMax device to check Absorbance at 280nm wavelength and got a concentration of about 0.8 mg/mL after calculations. I also did BCA assay and used the same device to read the absorbance at 562nm wavelength and got a much lower concentration 0.14 mg/mL. Which method is more accurate in this case?
My protein is Tau441 and the sequence is below:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLK
PLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAA AQ
PHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSK DGTGSDD
KKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSG
EPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTP
PKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINK
KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLG N
IHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHK
LTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSI DMVDSP
QLATLADEVSASLAKQGL
Thank you.
Can anyone explain the difference between water-soluble cholesterol (sold by Sigma, C4951) and regular/natural/chemically pure cholesterol, which must be insoluble in water? How can we measure free cholesterol in plasma by oxidation with cholesterol-oxidase in commercial assays if cholesterol is (theoretically) insoluble in water?
Hi everyone! I recently conducted a research study investigating the impact of virtual reality (VR) on learning and memory of difficult knowledge. The results I obtained from administering the PANAS questionnaire revealed some interesting findings. Specifically, participants reported experiencing more positive emotions when exposed to VR compared to a regular film. However, there were no notable differences between the groups in terms of negative emotions measured by the PANAS. It's worth noting that the negative emotions reported were generally lower than the positive emotions. This raises the question: could there be a Neuroscientific explanation behind these findings?
Einstein once said that 3D solid geometry was nothing but physics.
We assume that the following unconventional formulas are products of the statistical transition matrix chains B:
i- Two 3D bodies of different shapes can only have the same volume V if they have exactly the same area A.
ii- The minimum value of the V/A ratio of a body of 3D geometry is equal to 1/6 and is satisfied by cubic geometric shapes.
iii-Two three-dimensional bodies of different shapes and of different materials can only have the same mass m if they both have exactly the same volume V and the same area A.
iii- Sabine's imperial formula for the reverberation time Tr in sound rooms:
Tr= constant * V/s A.
is deduced in a regular way via the chains of the matrix B.
. . . etc.
Hi, I am not a material engineer and I am curious about whether the regular crystallization of a material makes it more strong or more fractile in comparison to irregular structures such as amorf in glass? Or changing regular zones orientation makes it harder?
Thanks.
Hello all
I would like to start working with human iPSC cells, and looking for protocols that I can use it for thawing, freezing, regular passaging, and differentiate of this cell line to neuronal cells.
Thank s in advance
I would to study apoptosis, but I haven't regular access flow cytometry to use Annexin V/PI staining. Could suggest me sensitive methods to investigate apoptosis?
Hello.
I'm predicting distribution using the Maxent model.
The jackknife test results are in three tables: regularized training gain, test gain, and AUC.
But I found all the test gain negative. The rest have no negative values.
The problem is that only in test data, both 'With only variable(blue bar)' and 'With all variables(red bar)' have negative values.
1. How should I interpret this? What does negative values mean?
2. Many papers mention only regularized training gain. Is test gain useless?
The sentence may be awkward because I used the translator.......
As there is section, Letter to Editor, does it carries equal weightage as the regular research paper.
These seem like plantings, but not on terraces nor. They appear to be an alternative way to ploughing and planting in furrows.
Dear Sirs,
It happens that I receive on my regular email requests for full text via Research gate, but when I open the link in my mail and access research gate I can't find the request anymore, so that I have to leave it unanswered. Could you please help me to solve this problem, or tell me how to reply and send the requested text?
Thank you,
Luigi
I work with primary cultures of human cells destined to tissue engineering therapies. I need to demonstrate that the cultured cells not develop any malignancies transformation, so I think in a soft agar assay, using T84 cells as a positive control.
But I think that the colony counting is a little weak method to reach any conclusion, since is greatly operator dependent. I found some colorimetric kits that use a microplate reader to convert the cell growth in an absorbance value.
I would like to try the same, with a regular spectrophotometer. But before that, I need to digest / dissolve the agarose in which the cells are trapped.
Do you have any experience with this asssay?
Although there are new attempts using the exotic atoms of hydrogen and deuterium since 2010 to measure the regular radius of the proton, is it legitimate to consider that the value 0.8758fm is until today the experimental value the most accurate for the regular radius of the proton which accords perfectly with the theory of the standard model of particle physics?
Do blood donations impact the health of the donors? How or why?
Regularization in Deep Learning .(CNN)
Hello,
I am using Mplus to conduct a latent transition analysis. I have examined both regular LTA and LTA with random intercepts and found that a five-class RI-LTA model best fits the data. Each class has three indicators. I also found that a full invariance model resulted in a significantly worse model fit than a non-invariant model. I want to test for partial invariance as a visual inspection of the results suggests that the means are very similar on specific indicators within a class across time but vary somewhat for other indicators. I want to check whether constraining specific means to equal across time improves model fit.
I have a couple of questions. When I estimated the RI-LTA, I only constrained the means, but should I also constrain the variances? Also, is there a simple way to determine if any means should be constrained to be equal, such as using modification indices? If not, should I label each indicator and compare them using the model test option?
Is a RI-LTA an appropriate method, or is a regular LTA fine? I chose this approach because I am examining change and stability in psychopathology across time and believe there might be some trait-like influences on stability. I found that factor loadings for conduct problems and hyperactivity are relatively high (between .55 and .85), but factor loadings for emotional problems are lower (around .20). From what I understand, this doesn’t necessarily suggest that RI-LTA is inappropriate, only that emotional problems are less stable across time.
Any suggestions or references to papers with relevant examples and syntax would be greatly appreciated.
My question is only loosely related to research, yet it concerns potential support for researchers. I was elected chair of one of the European research association's Member Services & Research Resources Committee, and I was wondering what approaches and tools may be used to improve the field of resources and member service. Regular online seminars and a mechanism (very basic and ineffective) for connecting members based on research interest criteria are currently in place. Do you know of any platform or technology that can be used to pair researchers for internal use? I'm also considering creating a data storage platform for secondary data analysis. What do you think about developing reserch reseources in research associacion? What are your experiences? Thanks in advance.
Hi everyone,
We know that for oncology drugs we have plenty of method for phase I dose escalation, but I'm wondering that is there any specific dose escalation scheme for drugs that is not for oncology (eg. diabetes).
Should I just use a regular 3+3 or some model-based method?
Thanks!!
The results of our research determined for the first time that for the entire frequency range of acoustic waves, the range of their propagation, measured not in units of measurement of distance, but in cycles, is a constant: the same number of cycles corresponds to the same absorption of acoustic energy. But the presence of correlation in this case is not related to the presence of a cause-and-effect relationship between the frequency of acoustic waves and their propagation distance.
It should be noted that there are signs that the obtained regularity can be extended to transverse waves in water. This is evidenced by the fact that, unlike shorter wind waves, long ocean surface (transverse) waves of spread over a distance of more than 1000 km. Tsunami waves, which have a length greater than the length of "Zibu" waves, spread over a distance of tens of thousands of kilometers. Seismic waves that propagate in the solid shell of the Earth, at lengths close to the length of tsunami waves, also propagate for tens of thousands of kilometers. In the future, different types of waves propagating in different environments can be considered, which does not exclude the possibility of confirming the general (universal) physically justified and understandable regularity of wave attenuation put forward by us.
The topic can be complex, but I am interested in the technique of heat kernel for the regularization of a divergent series at a specific point b=0. I mean, if one already knew a convergent series for each point b (being b different to zero where the series diverges), can I transform the divergent series at b=0 in a convergent series at b=0 by the heat kernel regularization or another technique to try to approach the series at the divergent point b=0? I see only the heat kernel or zeta function regularization as potential candidates for fixing divergent series when a specific value b is studied.
Let me know PDFs or links about the regularization from convergent series that diverges at b=0. Particularly I am interested in what has been exposed in this link: https://math.stackexchange.com/questions/1964838/equivalence-of-regularization-schemes-of-divergent-series/4597704#4597704
As the approach seems to be very interesting.
Best regards
Carlos L.
Dear members,
I have read about multiples techniques for regularizing a summation, I would like to know the technique for the case
How to regularize the divergent summation Σ ((1-l*π)^2n)/l^2 where the index is l=1, 2, 3...
For any n (natural n=1, 2, 3,... ) where the summation diverge and needs the regularized summation.
Best regards,
Carlos
I used QIAseq QuantiMIZE DNA_96 kit to evaluate DNA quality of FFPE samples.
After PCR run, I have the amplification plot attached here.
Any possible explanation on why the curves are different from a regular qRT-PCR?
In case someone used this kit did the amplification plot appears similar to mine? Please, if possible attach a photo here.
Thanks
When modelling the softening behavior of quasi-brittle materials as concrete, mesh sensitivity is very important unless we use a regularization technique. In tension there are many available in the literature, but what are the techniques available for compression?
I grew these HEK293 cells in the regular media and changed to serum-free media at 50% confluency to stop duplication of the cells. But after changing to serum-free media, some of the cells show a round shape, seems they are shrinked. Are my cells contaminated?
I have two points along a straight line path. Each of these points has associated with it weather forecast data in the form :
[forecast time, direction, speed]
I need to generate direction and speed predictions along a route between these points at regular intervals (e.g. 10m or 10s)
I have seen a lot of methods using four points for speed interpolation but these do not work well for only two points.
Any suggestions?
Similarly can all actinomorphic flowers be Regular??
Thanks.
funding agencies for geriatric research projects
I am sharing an incubator and I am used to using sterile water and regular cleaning program to keep my water sterile. However, the copper sulfate keeps being added to the incubator. I have heard this is common practice for other types of cell culture but I am wondering if this is something that could affect a more fussy type of cell such as stem cells.
I am planning to apply for small budget project. Is there any funding agencies, which receive application for grant on regular basis?
I would like to convert grid coordinates projection to longitude latitude (lonlat) by CDO.
but I am getting error
cdo setgridtype (Abort): Unsupported grid name: lonlat
Using this Command
cdo setgridtype,lonlat projection .nc regular_coordination.nc
is this can I use or I should use different? please let me know the correct Command
Does anybody know any physical argument for using zeta function regularization?
Or it is an open question?
Thanks.
Hi friends,
So I'm new to cell culturing research and synthetic biology and I'm working with MDA-MB-231 cells. Fairly regularly I have to at least split plates in order to maintain the cells, but I am also passaging cells for other things. Normally on a 10cm petri dish I'd plan to seed ~5.0E5 cells/mL for regular splitting and in a 96 well plate I'd seed ~4.5E4 cells/mL for my experiments. One thing I'm confused on still is using the hemocytometer to calculate cell density because I'm not entirely sure what my dilution factor should be.
Normally, I'll remove the old media, wash with PBS then trypsinize cells, after incubating for 5mins I add a bit more media until the total volume is 10mL, then I spin everything down. After that, I aspirate out the supernatant and am left with a small pellet of cells that I then break up and dilute with ~2-6mL of fresh media before using the hemocytometer to count the number of cells in 10uL.
My question is since I'm removing all the old media after centrifugation but then am adding new (different amount) media prior to counting, how does that impact the overall dilution factor?
Here's an example of what I was taught to do to find the amount of cells in 1mL, I just wanted to confirm that I'm on the right track. I was told if I resuspended my pellet in 3mL of media and then counted 75 cells I'd have:
75 cells/10E-4mL media
75 E4 cells/1mL media
7.5E5 cells/1mL media --> multiply this by 3 since you used 3mL to dilute before counting to get total number of cells (is this what accounts for the dilution factor?)
Total of 2.25E-6 cells that could be split however you see fit? Sometimes determining how many plates to get out can feel like a guessing game. Let me know if you see any issues with my method or suggestions that might be helpful, I welcome them. Please do try to be kind as I'm still learning and figuring things out. Thank you.
Kylie
I am a regular PhD scholar in Dept. of Mathematics at National Institute of Technology Meghalaya, Shillong, from July, 2017. At the end of July, 2022, 5 years of my PhD is to complete, and then I will not get fellowship. I want to join some college as the post of Assistant Professor, from August, 2022, and to continue my PhD work for 1 year more; and I want to request my institute (NIT Meghalaya) to allow me to do PhD work from home, I don't want to convert my regular PhD to part-time PhD; can it be allowed to me officially to do so, if yes, what would be the process? Please give some advices.
Thank you.
Why do cockpit windows often appear to have a rainbow ‘tint’?
Irosting. Some window parts, especially on the sides and far from the electrical contacts, would dissipate less heat, and defrosting would be significantly less efficient
Most regular male condoms contains anti-spermicidal agent. The woman is looking for a child. It is been used as a probe sheath for TVS.
It is my observation that RG lists name of each regular department at each university heading. But, there are some departments that are not similar in each country. One example is "Department of Public Finance". This field is organized as a separate department in Turkey. In US, it is not named a separate department. It is a part in department of economics. It may have different structure in different countries.
My point here is that those public finance scholars look for their department listing, and have no option to list their name. Some of them put their names on similar department listing such as department of economics or department of finance.
How to correct this technical issue? Suggestions?, thoughts?
I want to solve nonlinear optimization. I find its solution by using Brent's method. in the case that there is no regularization. Since the derivative is not used in this method, can anyone guide me on how I can solve the problem by considering regularization? Is there any way?
Orthogonal functions are often used for image processing (e.g., FFT, Radon transform, sinogram, SVD used in transmitting images from deep space probes). There are lots of examples in my book, which will be free on 5/10. I have attached a zip file containing all of the examples. https://www.amazon.com/dp/B07GT8TLDV
Im guessing one of my horizons isnt a regular surface, anyone know how to change it? or what the error message means?
using Petrel 2021
I have U2OS Flp-In Trex cells, but not the regular U2OS Flp-Ins. The only difference is the Trex are made using an additional pcDNA6/TR (Tet repressor). Normally you would transfect with pcDNA/FRT/TO which contains a CMV promoter followed by a Tet operator. Could I just transfect with pcDNA/FRT to create the stable that would not be affected by the Tet repressor? Also, the Tet repressor is blasticidin resistant. Could I also remove blast from the selection media to then enrich for cells lacking the Tet repressor before using the non-TetO pcDNA/FRT?
Thanks everyone!
hello
In my wear simulation, I need to define 18000 cycles. Defining the numerous cycles take much time, so it is not possible to utilize the regular method. I found a paper about high cycles fatigue that the authors used the Jump-in-cycles algorithm.
I did not find more things about this algorithm. Can you help me how define this algorithm in Abaqus for my wear simulation?
Thanks,
and for Total Variation optimization how to frame the objective function having L1 norm function
then what is the alternative way of imposing Total variational regularizer .
If yes, then what are the factors that need to be taken into consideration?
Hi all,
I've been attempting to ligate illumina adapters to a PCR amplified dsDNA fragment (sticky ends, 4bp overhang) but on all of my gels I can see the adapter and the insert separately, not ligated together.
I think part of this has to do with my insert (59bp) being so close in size to my adapters (79bp and 69bp). For this reason I have been using a 1:1 ratio of insert:adapter. I have tried 1ng, 100ng, 200ng, and 500ng. I have tried using the Blunt/TA Master Mix (NEB#M0367) with equal volumes of master mix and DNA/Adapter. I have also tried regular T4 Ligase (NEB#M0202), in a 50µL rxn I use 5µL T4 buffer and 100 Units T4 Ligase (I just scaled it from the protocol online-- is that too much?)
When I amplify the ligations (using primers that bind to the restriction enzyme cut site, I call them "bridge primers" because they bridge the insert to adapters) I get a product of the desired size, but when I send the sample for sequencing the only sequences that align are where the bridge primers bind.
I would love any advice on this, and I also have one specific question: I heard that spin column cleanup is not an ideal method for downstream ligations. Since my insert is PCR amplified, is there any other cleanup I can use to remove the excess salts and EDTA that might be an issue? I am doing SPRI bead cleanups between ligations, but what about cleaning up the PCR product before ligation?
Re: ARTICLE: "Should Type Theory replace Set Theory as the Foundation of Mathematics?" BY
Thorsten Altenkirch
Type Theory is indicated (by the author) to be a sometimes better alternative and a sometimes-replacement for regular set theory AND thus a sometimes better replacement for the logical foundations for math (and Science). It seems to allow turning what is qualitative and not amenable to regular set theory into things that can be the clear particular objects of logical reasoning. Is this the case? (<-- REALLY, I am asking you.)
It is very rarely, if ever, I have addressed anything that I did not have a good understanding of; BUT, here is the exception (and a BIG one). (I HAVE VERY, VERY little understanding of this Article -- even from the most crude qualitative standpoint. You would say I should have researched this more, but it in not my bailiwick , only more confusion, on my part would likely occur, "shedding no light". My sincere apologies. ANYHOW:
:
If indeed things are as the author, Thorsten Altenkirch, says: it seems different things (other than those related to standard propositions in regular set theory) could widen the use of set theory itself yet retaining (including) all of regular set theory (with all of its virtues, as needed). BUT, in addition it is indicated it could be applied to areas (PERHAPS, like biological and behavior science) where present set theory (and the math founded on it) cannot now be applied.
"[ The ] type theoretic axiom of choice hardly corresponds to the axiom of
choice as it is used in set theory. Indeed, it is not an axiom but just a derivable
fact."
More Quoting of the author: "Mathematicians would normally avoid non-structural properties, because they entail that results are may not be transferable between different representations of the same concept. However, frequently non-structural properties are exploited to prove structural properties and then it is not clear whether the result is transferable." .... "And because we cannot
talk about elements in isolation it is not possible to even state non-structural properties of the natural numbers. Indeed, we cannot distinguish different representations, for example using binary numbers instead." ... "we can actually play the same trick as in set theory
and define our number classes as subsets of the largest number class we want to
consider and we have indeed the subset relations we may expect. ... Hence Type Theory allows us to do basically the same things as set theory"
... as far as numbers are concerned (modulo the question of constructivity) but in a more disciplined fashion limiting the statements we can express and prove to
purely structural ones."
"we cannot talk about elements in isolation. This means that we cannot observe
intensional properties of our constructions. This already applies to Intensional
Type Theory, so for example we cannot observe any difference between two
functions which are pointwise equal." ...
"...Hence in ITT (regular set theory) while we cannot distinguish extensionally equal functions we do not identify them either. This seems to be a rather inconvenient incomplete-
ness of ITT, [ (common set theory)] which is overcome by Type Theory (HoTT)"
"[It] reflects mathematical practice to view isomorphic structures as equal.
However, this is certainly not supported by set theory which can distinguish
isomorphic structures. Yes, indeed all structural properties are preserved but
what exactly are those. In HoTT all properties are structural, hence the problem
disappears. ..."
"While not all developments
can be done constructively it is worthwhile to know the difference and the difference shouldn’t be relegated to prose but should be a mathematical statement." [AND}: ...
"Mathematicians think and they often implicitly assume that
isomorphic representations are interchangeable, which at closer inspection isn’t
correct when working in set theory. Modern Type Theory goes one step further
by stating that isomorphic representations are actually equal, indeed because
they are always interchangeable."...
..."The two main features that distinguish set theory and type theory: con-
structive reasoning and univalence are not independent of each other. Indeed
by being more explicit about choices we have made we can frequently avoid
using the axiom of choice which is used to resurrect choices hidden in a proposition. Replacing propositions by types shows that that the axiom of choice in many cases is only needed because conventional logic limits us to think about propositions when we should have used more general types."
Oh, here's the link to THE ARTICLE:
For my stress test design, it would be less invasive if I would be able to assess some important hormones such as insulin and grhelin in blood spots, instead of a regular blood draw. Does any one of you know whether this is possible?
I will be collecting blood and separating plasma for a study. The location of the blood draw will be about 30 minutes away from the lab where the samples can be stored. I have the option of separating the plasma at the location of the blood draw and storing it in a freezer until it can be transported to the other lab, which has a -80 degree freezer. The caveat is that the freezer that would be used for temporary storage is a standard/regular freezer (not -80). Does anyone know if temporary storage in a regular freezer for a week or two prior to transferring to a -80 freezer would compromise sample integrity?
What could be the effect of Waste Plastic irregular chips on the bearing capacity of compacted Soils? And If the Plastic is cut into regular shaped stirrups then how different will be the resulting improvement, if any?
I need to measure viscosity of a ceramic slurry at a shear rate betewen 10 and 200 s-1. The paste might have a viscosity between 3 and 5 Pa.s. I checked the regular spindles from brookfield and they would not be able to measure such viscosity. Does anyone know how to overcome this challenge?
The comparative explanation of inverted geometry with regular would be helpful.
The story of publishing papers in journals is twofold; before and after Covid-19. I have this classification because when I compare the APCs of journals before and after Covid-19, I see that there is a big increment. But, there is another option, submitting the paper to the special issues with very low APCs. Right here I have these questions. What is the difference between publishing papers on special issues and regular issues? What are the advantages of getting published in the special issues? What is the reliability of getting published in the special issues?
In case of determining the release rate of a tablet in an acidic (0.1N HCl) media or basic media (Phosphate buffer) by USP Apparatus- II (Paddle method) when we take the sample from the vessel after a regular intervals (i.e 10min, 20min,30 min and so on) to measure the UV-VIS absorbance, is it necessary to dilute the sample before taking absorbance?
If we dilute the sample, won't it affect in the release rate of the sample tablet?
Can anyone help me to formulate my research question for a thesis paper? I would like to do a research regarding the influence of sustainable development agenda 2030 on migration flows and human rights. Yet I also want to include in my research the fact, that not only safe and regular migration can help to achieve sustainable development, but the agenda 2030 can also have a positive impact on regular migration and human rights security (may be with a reference to gender issues or climate refugees).
I will be grateful of you could help me out!
Thank you!
Hello! I have been having an issue with large, regular peaks appearing in my HPLC runs that have been making the instrument unusable. In short, when running gradient runs on the instrument (Waters 2535 Quaternary Gradient Module), I get large peaks that increase in frequency and intensity as the gradient increases. This problem is constant and occurs when using any of the 4 columns we have.
Below is an example run (50-100% ACN, 28min) with the following parameters:
A: H2O, 0.1%TFA B: ACN, 0.1%TFA
C18 or C8 column, 4.6x100mm
flow: 1mL/min.
T A B
0 90 10
1 50 50
12 0 100
20 0 100
21 90 10
28 90 10
https://imgur.com/a/tFqO7T5
-There are no obvious pressure spikes that co-occur with the peaks in the spectrum. The pressure profile itself is quite consistent; a sawtooth/zipper-shaped pattern with a maximum delta of ~35psi .
-The issue is also present when using methanol, but to a lesser degree.
-Varying the flow rate only changes the spacing between peaks and when the first peak 'elutes'
I assume the issue is something like a bad pump seal, but I am just trying to make sure before we shell out the money for an expensive repair kit. It could also be an issue in the gradient proportioning valve, but I don't know how to distinguish between that and a high-pressure pump issue. I do not think this is a contamination issue. The peaks are far too regular and consistently eluting. Their absorbance intensity shows no decrease across runs.
Things I have tried:
-Remaking solvents fresh daily, from multiple different HPLC-grade solvent containers. No change.
-Flushing the entire system with IPA. No change.
-Switching lines. Normally we use lines A and B. I switched to C and D and saw a very minor improvement, but the issue was still there.
-No injection. No change
-No column. Inconclusive, we didn't have the correct fitting to create sufficient backpressure.
Any help would be appreciated!
Hello, I am trying to figure out how to convert multiple Grib2 files from a polar stereographic grid to a regular grid type all at once. I have figured out how to do it for one grib2 file at a time
(cdo setgridtype,regular <input grib> <output grib>), but I am having trouble figuring out how to convert 367 Grib2 files to a regular grid type all at once. Any suggestions are appreciated, thank you.
How to run lasso, ridge, and elastic net logistic regression for the categorical independent variables and a multilevel dependent variable?
