ArticlePDF Available

Abstract and Figures

Antimicrobial peptides are widespread in nature and are produced by many organisms as a first line of defence against pathogens. These peptides have a broad range of biological activities, such as antibacterial or antifungal activities and act with varied mechanisms of action. A large number of the peptides are amphipathic α-helices which act by disrupting plasma membranes and allowing leakage of intracellular contents. However, some peptides have more complex mechanisms of action that require internalisation into the target organisms' cytoplasm. The method by which these peptides enter the cytoplasm varies, with some requiring the energy dependent processes of endocytosis or polyamine transport and others entering via passive transport. Here we describe the mechanism that the antimicrobial peptide, the plant defensin NaD1, uses to transverse the fungal membrane and gain access to the fungal cytoplasm. By inhibiting ATP synthesis and using an inhibitor of actin polymerisation, we show that NaD1 is internalised into C. albicans yeast cells by the energy-dependent process of endocytosis.
BODIPY-NaD1 uptake occurs in three steps. C. albicans DAY185 was treated with 10 µM BODIPY-NaD1 and 5 µM PI and imaged every 5 s with a confocal microscope. (A) Each panel shows a C. albicans cell at four time-points. Each panel shows the first instance of the described phenotype. White light, BODIPY-NaD1 and PI images are shown for each time point. At the first time-point BODIPY-NaD1 is present on the cell surface. The second time-point shows the moment that BODIPYNaD1 and PI enter the cytoplasm. By the third time-point the BODIPY-NaD1 has filled the entire cytoplasm. At the last time-point PI accumulation levels off. Scale bars = 5 µM. Images are a representative example of three independent experiments, which gave equivalent results. Cells shown were chosen at random; (B) A box-and-whisker plot showing the time delay (in min) from the moment BODIPY-NaD1 is visible on the cell surface to when it first enters the cytoplasm for 70 individual cells. Three independent experiments were performed and a single field of view was analysed for each biological replicate. All cells that were applicable (i.e., had not yet accumulated NaD1 on the cell surface) were analysed and the frames counted between when BODIPY-NaD1 was first observed bound to the cell surface and when uptake occurred; (C) A box-and-whisker plot showing the time delay (in min) from the moment BODIPY-NaD1 first enters the cytoplasm to the moment the entire cytoplasm is fluorescent for 95 individual cells. Three independent experiments were performed and a single field of view was analysed for each biological replicate. All cells that were applicable (i.e., had not yet internalised NaD1) were analysed and the frames counted between when uptake first occurred to when NaD1 filled the entire cytoplasm.
… 
Content may be subject to copyright.
Fungi
Journal of
Article
The Plant Defensin NaD1 Enters the Cytoplasm of
Candida albicans via Endocytosis
Brigitte M. E. Hayes, Mark R. Bleackley, Marilyn A. Anderson and Nicole L. van der Weerden *
La Trobe Institute for Molecular Science, La Trobe University, 3086 Melbourne, Australia;
B.Hayes@latrobe.edu.au (B.M.E.H.); m.bleackley@latrobe.edu.au (M.R.B.);
M.Anderson@latrobe.edu.au (M.A.A.)
*Correspondence: N.VanDerWeerden@latrobe.edu.au
Received: 30 December 2017; Accepted: 3 February 2018; Published: 6 February 2018
Abstract:
Antimicrobial peptides are widespread in nature and are produced by many organisms as
a first line of defence against pathogens. These peptides have a broad range of biological activities,
such as antibacterial or antifungal activities and act with varied mechanisms of action. A large
number of the peptides are amphipathic
α
-helices which act by disrupting plasma membranes and
allowing leakage of intracellular contents. However, some peptides have more complex mechanisms
of action that require internalisation into the target organisms’ cytoplasm. The method by which
these peptides enter the cytoplasm varies, with some requiring the energy dependent processes of
endocytosis or polyamine transport and others entering via passive transport. Here we describe the
mechanism that the antimicrobial peptide, the plant defensin NaD1, uses to transverse the fungal
membrane and gain access to the fungal cytoplasm. By inhibiting ATP synthesis and using an
inhibitor of actin polymerisation, we show that NaD1 is internalised into C. albicans yeast cells by the
energy-dependent process of endocytosis.
Keywords: fungi; antifungal peptides; plant defensin; endocytosis; Candida albicans
1. Introduction
Fungal disease is an increasing problem affecting both agriculture and human health [
1
,
2
].
With increasing incidence of human disease, particularly in immunocompromised individuals and
the emergence of resistance to the current antifungal therapies [
3
6
], antimicrobial peptides are an
attractive alternative method of treatment [
7
]. Antimicrobial peptides are innate immunity molecules
produced by all organisms including plants, animals and insects [
8
]. Antimicrobial peptides are
typically small, cationic molecules and many form amphipathic
α
-helices which act by binding to and
disrupting lipid bilayers [
8
,
9
]. However, there are also more complex antifungal peptides that do more
than simply disrupting membranes [10].
One such group of peptides is the plant defensins, many of which are potent antifungal
molecules [
11
]. We have previously described the plant defensin NaD1, from ornamental tobacco,
which has potent activity against both agricultural and human pathogens [
12
,
13
]. The mechanism of
action of NaD1 is complex. Firstly, it interacts with components of the fungal cell wall [
14
]. The peptide
then enters the cytoplasm and reactive oxygen species are produced [
12
,
13
]. The plasma membrane
is then permeabilised and cell death occurs. Similarly, another plant defensin MtDef4 from the
model legume Medicago tranculata enters the Fusarium graminearum cytoplasm before membrane
permeabilisation and cell death [
15
]. We have hypothesised that permeabilisation of the membrane
after NaD1 treatment is a result of interaction with phosphatidylinositol 4,5 bisphosphate (PI(4,5)P
2
)
on the inner leaflet of the membrane. NaD1 binds to PI(4,5)P
2
on lipid strips and can permeabilise
PI(4,5)P
2
containing liposomes [
16
]. However, the mechanism by which NaD1 gains access to the
cytoplasm has not been elucidated.
J. Fungi 2018,4, 20; doi:10.3390/jof4010020 www.mdpi.com/journal/jof
J. Fungi 2018,4, 20 2 of 15
Different mechanisms have been described for passage of antimicrobial peptides through the
plasma membrane, including endocytosis, polyamine transporters and passive transport. For example,
the Penicillium antimicrobial peptide PAF is internalised by endocytosis. This was revealed when PAF
did not enter cells that had been treated with carbonyl cyanide m-chlorophenyl hydrazone (CCCP),
an uncoupler of oxidative phosphorylation [
17
], or cells maintained at 4
C indicating that energy is
required for PAF uptake [
18
]. In addition, inhibition of actin polymerisation, which is required for
endocytosis in yeast [
19
,
20
] blocks PAF internalisation into Aspergillus nidulans hyphae [
18
]. Similarly,
uptake of the plant defensin MtDef4 into Neurospora crassa hyphae is reduced at 4
C and was abolished
when ATP production was blocked with sodium azide. Uptake of this defensin was also reduced
in N. crassa cells after treatment with brefeldin A, which blocks retrograde transport and filipin,
an inhibitor of lipid raft dependent endocytosis [15].
Polyamine transporters also function in the uptake of cationic peptides. For example, the human
antifungal peptide, histatin 5, enters C. albicans cells via the polyamine transporters Dur3p and
Dur31p. Deletion of these transporters reduces histatin 5’s antifungal activity [
21
] and expression of
the transporters in a histatin 5 resistant Candida glabrata strain renders them sensitive to the peptide [
22
].
In addition, when the polyamines spermidine or spermine were added to C. albicans along with histatin
5, cells were more resistant to the peptide. Furthermore, uptake of FITC labelled histatin 5 into
C. albicans was blocked by addition of spermidine [
21
]. Like PAF, CCCP, the uncoupler of oxidative
phosphorylation, also blocks the antifungal activity of histatin 5, although in this instance it is likely
due to impairment of the energy requirement of the polyamine transporter, as CCCP also blocks the
uptake of spermidine into C. albicans cells [21].
Passive transport is the mode of entry of certain cell-penetrating peptides (CPPs) in accessing
the cytoplasm. These peptides are small (less than 30 amino acids long) and positively charged [
23
].
One such CPP is the synthetic peptide transportan, a 27 residue variant of the peptide galparan,
which was derived by fusion of the neuropeptide, galanin, with the wasp venom peptide,
mastoparan [
24
]. Passage of this peptide across the plasma membrane and entry into the cytoplasm
is likely to occur via direct penetration, as uptake is not inhibited by low temperatures (4
C), nor is
it blocked by phenylarsine oxide, an inhibitor of clathrin-mediated endocytosis, phagocytosis and
macropinocytosis [20,23,24].
In this study, we investigated the mechanism by which the plant defensin NaD1 enters the
cytoplasm of C. albicans cells. We show that NaD1 uptake is essential for killing and that uptake
occurs through the energy dependent process of endocytosis. Furthermore, we show that a secondary
method of killing that does not require endocytosis may occur at higher NaD1 concentrations and
that once internalised, NaD1 does not require the cell’s internal protein transport machinery to have
antifungal activity.
2. Materials and Methods
2.1. Protein Source
NaD1 was purified from the flowers of Nicotiana alata as described in
van der Weerden et al.
(2008) [
12
]. In brief, flowers were crushed in a mortar and pestle with liquid nitrogen and
then subjected to an acid and heat treatment. Protein was then purified using cation-exchange
chromatography and reverse-phase high-performance liquid chromatography (RP-HPLC).
The protein concentration was determined using the bicinchoninic acid (BCA) protein assay
(ThermoFisher, Scoresby, Australia). NaD1 was fluorescently labelled with 4,4-Difluoro-5,7-Dimethyl-
4-Bora-3a,4a-Diaza-s-Indacene-3-Propionyl Ethylenediamine, Hydrochloride (BODIPY-FL-EDA, Life
Technologies, Carlsbad, CA, USA) as described in [
13
]. The LL-37 peptide (amino acid sequence:
[LL-37, 37 aa]) was synthesised by GenScript (Piscataway,
NJ, USA).
J. Fungi 2018,4, 20 3 of 15
2.2. Fungal Strains
All C. albicans strains were obtained from the fungal genetic stock centre [
25
] and are described
in [
26
28
]. Strains were derived from the BWP17 background strain (ura3::imm434/ura3::imm434
iro1/iro1::imm434 his1::hisG/his1::hisG arg4/arg4). The DAY185 wild-type C. albicans strain (ARG4+,
URA3+, HIS1+) was used in most assays. For testing of C. albicans ESCRT mutants, DAY286 (ARG4+,
URA3+, his1-) was used as the wild-type strain. C. albicans ESCRT (ARG4+, URA3+, his1-) mutants
were produced by transposon insertion [
28
]. Strains were grown in yeast extract-peptone dextrose
(YPD) at 30
C with shaking (250 rpm). For C. albicans mutant strains, YPD was supplemented with
80 µg/mL uridine.
2.3. Confocal Microscopy
C. albicans DAY185 overnight cultures were diluted in half-strength potato dextrose broth (PDB;
Becton Dickinson, Scoresby, Australia) to an OD
600
of 0.2 and grown for a further three hours (30
C,
250 rpm). Cells were then diluted to an OD
600
of 0.3 with half-strength PDB. For time course
experiments, 300
µ
L aliquots (in 1.5 mL microcentrifuge tubes) were pre-treated with 5
µ
M propidium
iodide (PI; Sigma, St Louis, MO, USA) for 10 min prior to addition of BODIPY- labelled NaD1.
For CCCP and latrunculin A experiments, yeast cells were pre-treated with 50
µ
M CCCP (Sigma) or
100
µ
M latrunculin A (AdipoGen, Liestal, Switzerland) for 2 h (30
C, 250 rpm) before addition of 5
µ
M
PI. BODIPY-NaD1 (10
µ
M) was then added and cells were monitored using a Zeiss LSM510/ConfoCor
confocal with images taken every 5 sec. BODIPY was excited at 488 nm (Argon laser) and emission
was detected at 505 to 530 nm. PI was excited at 561 nm (DPSS laser) and fluorescence was monitored
at 575 to 615 nm. Images were captured using Zen2009 (Zeiss, Oberkochen, Germany) software and
analysed using FIJI (Bethesda, Rockville, MD, USA) [
29
]. Brightness and contrast for Figures 1,3and 4
were adjusted using the auto-brightness/contrast function of FIJI.
2.4. Flow Cytometry
C. albicans DAY185 overnight cultures were diluted in half-strength potato dextrose broth (PDB)
to an OD
600
of 0.2 and grown for 3 h (30
C, 250 rpm) before they were diluted again to an OD
600
of
0.1 with half-strength PDB and used in cell death and NaD1 uptake assays. Cell death assays were
conducted by treating 300
µ
L of C. albicans cells with 0, 5, 10 or 20
µ
M of native NaD1 or LL-37 and 5
µ
M
PI. NaD1 uptake at 4
C was measured by treating 300
µ
L of cells with 0, 5 or 10
µ
M BODIPY-labelled
NaD1. All treatments were conducted for 30 min at either 30
C or 4
C without shaking and in the
dark. For brefeldin A and nocodazole experiments, 300
µ
L of cells were pre-incubated with 40
µ
M of
each inhibitor for 2 h at 30
C (with shaking). Cells were then treated with 10
µ
M of BODIPY-NaD1 for
15 min. For all experiments, cells were pelleted after treatment by centrifugation at 13,000 rpm for 2 min.
The supernatant was removed and cells were resuspended in 300
µ
L of 1
×
phosphate buffered saline
(PBS) before analysis using a BD FACSCanto II cytometer (Scoresby, Australia). For BODIPY-labelled
NaD1, cells were excited at 488 nm and emission was detected using a 530/30 filter. For PI, cells were
excited at 488 nm and emission was detected using a 670LP filter. Data were analysed using Weasel
v3.0 (Walter and Eliza Hall Institute, Parkville, Australia).
2.5. Growth Inhibition Assays
Fungal growth inhibition assays were performed essentially as described in [
30
]. Overnight
cultures of C. albicans cells were diluted to 5000 cells/mL with half-strength PDB. For growth inhibition
assays in the presence of latrunculin A, 80
µ
L of diluted C. albicans DAY185 cells were added to 10
µ
L of
latrunculin A and 10
µ
L of NaD1 in a 96 well microtiter plate (Greiner, Kremsmünster, Austria) to final
concentrations of 2.5, 3, 4 and 4.5
µ
M NaD1 and 0 or 20
µ
M latrunculin A (AdipoGen). For brefeldin
A and nocodazole assays, 80
µ
L of diluted C. albicans DAY185 cells was added to 10
µ
L of inhibitor
and 10
µ
L of NaD1 in a microtiter plate. Brefeldin A (Sigma) and nocodazole where serially diluted
J. Fungi 2018,4, 20 4 of 15
(two-fold) down the plate with top final concentrations of 40
µ
M and 20
µ
M respectively. NaD1
was added to all wells at a final concentration of 2.5
µ
M. No-inhibitor controls were also included.
For testing the antifungal activity of NaD1 against the C. albicans ESCRT mutants, 80
µ
L of diluted
cells (DAY286 wild type and mutants) were added to 20
µ
L of NaD1 serially diluted from a top final
concentration of 10
µ
M. All plates were incubated at 30
C overnight without shaking. Growth of cells
was monitored by measuring absorbance at 595 nm in a SpectraMAX M5e plate reader (Molecular
Devices, San Jose, CA, USA). Measurements were taken at t= 0 and t= 24 h.
3. Results
3.1. NaD1 Uptake into C. albicans Cells Occurs in Three Stages
We have previously described the three step mechanism of action of NaD1 against fungi, which
involves binding to the cell surface, internalisation of the peptide into the cytoplasm and induction
of reactive oxygen species (ROS) [
12
,
13
]. To further investigate the timing of these steps, confocal
microscopy time-course experiments were performed using fluorescently labelled NaD1 and the
death marker PI. A time-course of the uptake of BODIPY-NaD1 into two individual cells is shown
(Figure 1A). In the first cell (left panel), BODIPY-NaD1 is bound to the cell surface and there is no
visible PI fluorescence. At 45 sec, BODIPY-NaD1 had started to enter the cytoplasm and a small amount
of PI fluorescence was observed. The appearance of the cell did not change for an additional 65 s (110 s
time-point), at which time the BODIPY-NaD1 had filled the cytoplasm. Over the following time period,
PI fluorescence increased until it levelled off at 330 sec. A similar sequence of events occurred with the
second cell (right panel). The median delay between accumulation of NaD1 on the cell surface and
uptake into the cytoplasm was 4 min (Figure 1B). The time between the first appearance of NaD1 in
the cytoplasm and peak fluorescence in the cytoplasm had a median of 0.67 min (Figure 1C).
3.2. NaD1’s Antifungal Activity and Uptake into Fungal Cells is Reduced at 4 C and after Treatment
with CCCP
At 4
C, endocytosis and other active cellular processes are blocked [
31
,
32
]. To determine if uptake
of NaD1 into fungal cells is an energy dependent process, C. albicans DAY185 cells were treated with
native NaD1 (with PI to monitor cell death), or with BODIPY-labelled NaD1 at 30
C or 4
C and uptake
into yeast cells was monitored by flow cytometry. There was less cell death when cells were treated
with NaD1 for 30 min at 4
C compared to 30
C (Figure 2Ai,Aii). In contrast, cell death following
treatment with the human cathelicidin LL-37 was not affected by the reduced temperature (Figure S1).
To determine if the reduction in cell death at 4
C had arisen from a decrease in NaD1 uptake into
the cytoplasm, the flow cytometry experiment was repeated with fluorescently labelled NaD1. Fewer
cells contained BODIPY-labelled NaD1 in the cytoplasm after incubation at 4
C compared to 30
C
(Figure 2Bi,Bii). This points towards an energy dependent method of uptake, such as endocytosis,
as the mechanism by which NaD1 enters C. albicans cells.
An inhibitor of oxidative phosphorylation, CCCP, was used to confirm that the uptake mechanism
of NaD1 is energy dependent. As expected, there was a decrease in BODIPY-labelled NaD1 uptake
and cell death (monitored by PI fluorescence) when cells were rendered energy deficient with a 50
µ
M
CCCP pre-treatment (Figure 3A). Interestingly, CCCP treatment also increased the proportion of cells
with BODIPY-labelled NaD1 on the cell surface. In the absence of CCCP, about 55% of cells had
internalised NaD1 and about 21% of cells had accumulated BODIPY-labelled NaD1 on the cell surface.
In contrast, about 20% of the CCCP pre-treated cells had NaD1 in the cytoplasm and about 50% of cells
had NaD1 restricted to the cell surface (Figure 3B). These data indicate that cell surface binding is not
affected by CCCP pre-treatment. However, passage through the plasma membrane requires energy,
as evidenced by the reduction in NaD1 uptake and the resulting increase in the number of cells with
NaD1 trapped at the cell surface.
J. Fungi 2018,4, 20 5 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 5 of 14
Figure 1. BODIPY-NaD1 uptake occurs in three steps. C. albicans DAY185 was treated with 10 µM
BODIPY-NaD1 and 5 µM PI and imaged every 5 s with a confocal microscope. (A) Each panel shows
a C. albicans cell at four time-points. Each panel shows the first instance of the described phenotype.
White light, BODIPY-NaD1 and PI images are shown for each time point. At the first time-point
BODIPY-NaD1 is present on the cell surface. The second time-point shows the moment that BODIPY-
NaD1 and PI enter the cytoplasm. By the third time-point the BODIPY-NaD1 has filled the entire
cytoplasm. At the last time-point PI accumulation levels off. Scale bars = 5 µM. Images are a
representative example of three independent experiments, which gave equivalent results. Cells
shown were chosen at random; (B) A box-and-whisker plot showing the time delay (in min) from the
moment BODIPY-NaD1 is visible on the cell surface to when it first enters the cytoplasm for 70
individual cells. Three independent experiments were performed and a single field of view was
analysed for each biological replicate. All cells that were applicable (i.e., had not yet accumulated
NaD1 on the cell surface) were analysed and the frames counted between when BODIPY-NaD1 was
first observed bound to the cell surface and when uptake occurred; (C) A box-and-whisker plot
showing the time delay (in min) from the moment BODIPY-NaD1 first enters the cytoplasm to the
moment the entire cytoplasm is fluorescent for 95 individual cells. Three independent experiments
were performed and a single field of view was analysed for each biological replicate. All cells that
were applicable (i.e., had not yet internalised NaD1) were analysed and the frames counted between
when uptake first occurred to when NaD1 filled the entire cytoplasm.
Figure 1.
BODIPY-NaD1 uptake occurs in three steps. C. albicans DAY185 was treated with 10
µ
M
BODIPY-NaD1 and 5
µ
M PI and imaged every 5 s with a confocal microscope. (
A
) Each panel
shows a C. albicans cell at four time-points. Each panel shows the first instance of the described
phenotype. White light, BODIPY-NaD1 and PI images are shown for each time point. At the first
time-point BODIPY-NaD1 is present on the cell surface. The second time-point shows the moment that
BODIPY-NaD1 and PI enter the cytoplasm. By the third time-point the BODIPY-NaD1 has filled the
entire cytoplasm. At the last time-point PI accumulation levels off. Scale bars = 5
µ
M. Images are a
representative example of three independent experiments, which gave equivalent results. Cells shown
were chosen at random; (
B
) A box-and-whisker plot showing the time delay (in min) from the moment
BODIPY-NaD1 is visible on the cell surface to when it first enters the cytoplasm for 70 individual
cells. Three independent experiments were performed and a single field of view was analysed for
each biological replicate. All cells that were applicable (i.e., had not yet accumulated NaD1 on the
cell surface) were analysed and the frames counted between when BODIPY-NaD1 was first observed
bound to the cell surface and when uptake occurred; (
C
) A box-and-whisker plot showing the time
delay (in min) from the moment BODIPY-NaD1 first enters the cytoplasm to the moment the entire
cytoplasm is fluorescent for 95 individual cells. Three independent experiments were performed and a
single field of view was analysed for each biological replicate. All cells that were applicable (i.e., had
not yet internalised NaD1) were analysed and the frames counted between when uptake first occurred
to when NaD1 filled the entire cytoplasm.
J. Fungi 2018,4, 20 6 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 6 of 14
Figure 2. NaD1 induced cell death and uptake is reduced at 4 °C. (Ai) C. albicans DAY185 was treated
with 0, 5 or 10 µM NaD1 for 30 min at 30° and 4 °C. PI (5 µM) was added for quantitation of cell death.
Cells with PI fluorescence were counted using a flow cytometer to separate living and dead cells at
both 30 °C (grey shading) and 4 °C (black line). Data is a representative example from three
independent experiments; (Aii) The percentage of PI positive cells (percent cell death) relative to total
cell counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the means. Values marked by an asterisk are significant (using an independent
t-test) compared to the 30 °C control (p-value < 0.05); (Bi) C. albicans DAY185 was treated with 0, 5 or
10 µM BODIPY-NaD1 for 30 min at 30° and 4 °C. Cells with BODIPY fluorescence were counted using
a flow cytometer and separated to determine the relative numbers of cells that had or had not taken
up BODIPY-NaD1 at 30 °C (grey shading) or 4 °C (black line). Data is a representative example from
three independent experiments; (Bii) The percentage of BODIPY-NaD1 positive cells relative to total
cells counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the mean. Values marked by an asterisk are significant (using an independent t-
test) compared to the 30 °C control (p-value < 0.05).
Figure 2.
NaD1 induced cell death and uptake is reduced at 4
C. (
Ai
)C. albicans DAY185 was treated
with 0, 5 or 10
µ
M NaD1 for 30 min at 30
and 4
C. PI (5
µ
M) was added for quantitation of cell
death. Cells with PI fluorescence were counted using a flow cytometer to separate living and dead
cells at both 30
C (grey shading) and 4
C (black line). Data is a representative example from three
independent experiments; (
Aii
) The percentage of PI positive cells (percent cell death) relative to total
cell counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the means. Values marked by an asterisk are significant (using an independent
t-test) compared to the 30
C control (p-value < 0.05); (
Bi
)C. albicans DAY185 was treated with 0, 5 or
10
µ
M BODIPY-NaD1 for 30 min at 30
and 4
C. Cells with BODIPY fluorescence were counted using
a flow cytometer and separated to determine the relative numbers of cells that had or had not taken up
BODIPY-NaD1 at 30
C (grey shading) or 4
C (black line). Data is a representative example from three
independent experiments; (
Bii
) The percentage of BODIPY-NaD1 positive cells relative to total cells
counts was also calculated for three biological replicates and is shown in a bar graph. Error bars are
standard error of the mean. Values marked by an asterisk are significant (using an independent t-test)
compared to the 30 C control (p-value < 0.05).
J. Fungi 2018,4, 20 7 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 7 of 14
Figure 3. NaD1 uptake is reduced after treatment with CCCP. (A) Confocal microscopy was used to
monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with CCCP. CCCP pre-
treated cells (50 µM CCCP) and no-inhibitor control (0 µM CCCP) cells were treated with 10 µM
BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images are shown. Scale bars = 40
µm. A subset of cells is also shown with increased magnification. Scale bars = 40 µm. Images are a
representative example of three independent experiments, which gave equivalent results. (B) Cell
counts were performed for four independent experiments and the percentage of BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error bars
are standard error of the mean (n = 4). Values marked by an asterisk are significant (using an
independent t-test) compared to the 0 µM CCCP control (p-value < 0.05).
3.3. NaD1 Uptake and NaD1 Induced Cell Death are Reduced in the Presence of the Actin Assembly
Inhibitor Latrunculin A
Having confirmed that uptake of NaD1 into C. albicans cells is an energy dependent process, we
questioned whether this uptake occurs via endocytosis. This was achieved by pre-treating C. albicans
cells with the inhibitor latrunculin A which blocks actin polymerisation into filaments, a step which
is essential for endocytosis in yeast [19,20]. After C. albicans cells were pre-treated for 2 h with 100 µM
latrunculin A, uptake of BODIPY-labelled NaD1 was significantly reduced, with approximately 20%
of cells containing NaD1 in the cytoplasm after 10 min of NaD1 treatment compared to about 40% of
cells in the no-inhibitor control (Figure 4). As with CCCP pre-treatment, there was an increase in the
number of cells with NaD1 bound to the cell surface. NaD1 was still bound to the fungal cell surface
but internalisation of the peptide was blocked, leaving a higher proportion of cells with surface
bound NaD1.
Figure 3.
NaD1 uptake is reduced after treatment with CCCP. (
A
) Confocal microscopy was used
to monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with CCCP. CCCP
pre-treated cells (50
µ
M CCCP) and no-inhibitor control (0
µ
M CCCP) cells were treated with 10
µ
M
BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images are shown.
Scale bars = 40 µm
.
A subset of cells is also shown with increased magnification. Scale bars = 40
µ
m. Images are a
representative example of three independent experiments, which gave equivalent results. (
B
) Cell
counts were performed for four independent experiments and the percentage of BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error
bars are standard error of the mean (n= 4). Values marked by an asterisk are significant (using an
independent t-test) compared to the 0 µM CCCP control (p-value < 0.05).
3.3. NaD1 Uptake and NaD1 Induced Cell Death are Reduced in the Presence of the Actin Assembly Inhibitor
Latrunculin A
Having confirmed that uptake of NaD1 into C. albicans cells is an energy dependent process, we
questioned whether this uptake occurs via endocytosis. This was achieved by pre-treating C. albicans
cells with the inhibitor latrunculin A which blocks actin polymerisation into filaments, a step which is
essential for endocytosis in yeast [
19
,
20
]. After C. albicans cells were pre-treated for 2 h with 100
µ
M
latrunculin A, uptake of BODIPY-labelled NaD1 was significantly reduced, with approximately 20%
of cells containing NaD1 in the cytoplasm after 10 min of NaD1 treatment compared to about 40%
of cells in the no-inhibitor control (Figure 4). As with CCCP pre-treatment, there was an increase in
the number of cells with NaD1 bound to the cell surface. NaD1 was still bound to the fungal cell
surface but internalisation of the peptide was blocked, leaving a higher proportion of cells with surface
bound NaD1.
J. Fungi 2018,4, 20 8 of 15
We also investigated whether latrunculin A blocked uptake when NaD1 was more concentrated.
In this assay, C. albicans cells were treated concurrently with 20
µ
M latrunculin A and increasing
amounts of NaD1. Lower concentrations of NaD1 were tested in this assay to account for lower
starting cell densities used in the fungal inhibition assays. We have previously published data
showing that increased cell densities require increased NaD1 concentrations to have a similar level
of activity [
13
]. Growth inhibition by 2.5
µ
M NaD1 (which is close to the IC
50
value of 2.3
±
0.6
µ
M
against C. albicans DAY185 previously reported [
13
]) was reduced in the presence of 20
µ
M latrunculin
A (Figure 5). However, latrunculin A did not protect the C. albicans cells when the NaD1 concentration
was increased to 4
µ
M. Thus, endocytosis appears to be the dominant mechanism of NaD1 uptake
at lower concentrations but uptake via endocytosis is not be required for cell death at higher NaD1
concentrations (concentrations higher than the IC50 value).
Figure 4.
NaD1 uptake is reduced after treatment with latrunculin A. (
A
) Confocal microscopy was
used to monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with latrunculin
A. Latrunculin A pre-treated cells (100
µ
M latrunculin A) and no-inhibitor control (0
µ
M latrunculin A)
cells were treated with 10
µ
M BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images
are shown. A subset of cells is also shown with increased magnification.
Scale bars = 40 µm
. Images
are a representative example of three independent experiments, which gave equivalent results; (
B
) Cells
counts were performed for three independent microscopy experiments and percent BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error bars are
standard error of the mean (n= 3). Values marked by an asterisk are significant (using an independent
t-test) compared to the 0 µM latrunculin A control (p-value < 0.05).
J. Fungi 2018,4, 20 9 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 9 of 14
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans. C. albicans DAY185
was treated with 20 µM latrunculin A only, NaD1 only or 20 µM latrunculin A and NaD1 in
combination. NaD1 was included at 2.5, 3, 3.5 and 4 µM. Data are relative to the 20 µM latrunculin A
only control. Error bars represent standard error of the mean (n = 3). Values marked by an asterisk are
significantly different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor
brefeldin A blocks retrograde transport from endosomes to the trans-Golgi network [33,34], while
nocodazole causes depolarization of microtubules leading to defects in endosome movement [35,36].
No significant difference was observed in the growth of C. albicans DAY185 cells when they were
treated with these two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway,
which is responsible for endosome trafficking and formation of late endosomes (or MVBs) [37,38],
did not reduce NaD1’s antifungal activity compared to C. albicans DAY286 wild type (Table 1). This
indicates that retrograde transport is not essential for the activity of NaD1.
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5 µM NaD1 only, inhibitors only or 2.5 µM NaD1 and (Ai) 20 µM brefeldin
A or (Bi) 20 µM nocodazole in combination. Data are relative to the inhibitor only controls. Error bars
represent SEM (n = 3). No values were significantly different (using an independent t-test) to the NaD1
only control (p-value > 0.05). C. albicans DAY185 was treated with 10 µM BODIPY-NaD1 for 15 min
with (Aii) 40 µM brefeldin A or (Bii) 40 µM nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans.C. albicans DAY185
was treated with 20
µ
M latrunculin A only, NaD1 only or 20
µ
M latrunculin A and NaD1 in combination.
NaD1 was included at 2.5, 3, 3.5 and 4
µ
M. Data are relative to the 20
µ
M latrunculin A only control.
Error bars represent standard error of the mean (n= 3). Values marked by an asterisk are significantly
different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor brefeldin
A blocks retrograde transport from endosomes to the trans-Golgi network [
33
,
34
], while nocodazole
causes depolarization of microtubules leading to defects in endosome movement [
35
,
36
]. No significant
difference was observed in the growth of C. albicans DAY185 cells when they were treated with these
two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway, which is responsible
for endosome trafficking and formation of late endosomes (or MVBs) [
37
,
38
], did not reduce NaD1’s
antifungal activity compared to C. albicans DAY286 wild type (Table 1). This indicates that retrograde
transport is not essential for the activity of NaD1.
J. Fungi 2018, 4, x FOR PEER REVIEW 9 of 14
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans. C. albicans DAY185
was treated with 20 µM latrunculin A only, NaD1 only or 20 µM latrunculin A and NaD1 in
combination. NaD1 was included at 2.5, 3, 3.5 and 4 µM. Data are relative to the 20 µM latrunculin A
only control. Error bars represent standard error of the mean (n = 3). Values marked by an asterisk are
significantly different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor
brefeldin A blocks retrograde transport from endosomes to the trans-Golgi network [33,34], while
nocodazole causes depolarization of microtubules leading to defects in endosome movement [35,36].
No significant difference was observed in the growth of C. albicans DAY185 cells when they were
treated with these two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway,
which is responsible for endosome trafficking and formation of late endosomes (or MVBs) [37,38],
did not reduce NaD1’s antifungal activity compared to C. albicans DAY286 wild type (Table 1). This
indicates that retrograde transport is not essential for the activity of NaD1.
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5 µM NaD1 only, inhibitors only or 2.5 µM NaD1 and (Ai) 20 µM brefeldin
A or (Bi) 20 µM nocodazole in combination. Data are relative to the inhibitor only controls. Error bars
represent SEM (n = 3). No values were significantly different (using an independent t-test) to the NaD1
only control (p-value > 0.05). C. albicans DAY185 was treated with 10 µM BODIPY-NaD1 for 15 min
with (Aii) 40 µM brefeldin A or (Bii) 40 µM nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5
µ
M NaD1 only, inhibitors only or 2.5
µ
M NaD1 and (
Ai
) 20
µ
M brefeldin
A or (
Bi
) 20
µ
M nocodazole in combination. Data are relative to the inhibitor only controls. Error
bars represent SEM (n= 3). No values were significantly different (using an independent t-test) to the
NaD1 only control (p-value > 0.05). C. albicans DAY185 was treated with 10
µ
M BODIPY-NaD1 for
15 min with (
Aii
) 40
µ
M brefeldin A or (
Bii
) 40
µ
M nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).
J. Fungi 2018,4, 20 10 of 15
Table 1. Deletion of ESCRT pathway components does not affect activity of NaD1.
IC50 (µM)
Wild type (DAY286) vps2vps23vps24vps28vps36snf7bro1
1.8 ±0.49 1.8 ±0.40 1.8 ±0.43 2.1 ±0.33 1.6 ±0.33 1.7 ±0.28 1.9 ±0.45 2.1 ±0.35
C. albicans DAY286 (WT), vps2
,vps23
,vps24
,vps28
,vps36
,snf7
and bro1
were treated with various
concentrations of NaD1. IC50
±
standard deviation of C. albicans ESCRT mutants treated with NaD1 are shown
(n= 4). No values were significantly (using an independent t-test) different from wild-type (p> 0.05).
4. Discussion
Plant defensins are a large family of peptides but the mechanism of action of only a few have
been elucidated. Those with identified mechanisms can be divided into two categories, those that
enter fungal cells and those that do not. To date, the peptides PsD1, MtDef4, HsAFP1 and NaD1
are the only plant defensins that have been reported to be internalised into cells as part of their
mechanism of action [
12
,
39
41
]. NaD1 traverses the cell wall and plasma membrane of F. oxysporum
f.sp. vasinfectum and C. albicans and accumulates in the cytoplasm [
12
,
13
]. In this study, we used
time-course experiments with fluorescently labelled NaD1 to investigate the timing of NaD1 uptake
into C. albicans cells (Figure 1). NaD1 initially accumulated on the cell surface and remained there for
a median time of 4 min (Figure 1B). The first stage of uptake then occurred with an influx of NaD1
together with a small amount of PI, into the periphery of the cytoplasm. After another 0.67 min,
the NaD1 was distributed across the entire cytoplasm and the organelles had started to disintegrate
(Figure 1C). The time delay between attachment of NaD1 to the cell surface and the presence of large
amounts of NaD1 and PI in the cytoplasm may reflect an initial uptake of a relatively small amount of
NaD1. This relatively small amount of NaD1 may then exert its toxic activity on cytoplasmic targets
leading to cell death and membrane permeabilisation and associated influx of NaD1 together with
PI. The variability in uptake timing may be due to a threshold amount of protein required to bind the
cell surface before uptake of the peptide, or membrane permeabilisation, can occur. It is also possible
that cell wall composition changes during the cell cycle may affect the rate of movement of NaD1
through the cell wall. The variability in the timing of NaD1 spread throughout the cytoplasm could
indicate that the mechanism of action is complex and requires many stages of action that could be
subject to delay.
The interesting observations about the timing of NaD1’s uptake into fungal cells, led to the
question of how NaD1 passes through the plasma membrane. Firstly, dependence on energy for uptake
of the peptide and cell killing was investigated using the uncoupler of oxidative phosphorylation,
CCCP. Treatment with CCCP can block endocytic uptake but also disrupts polyamine transporters, as
evidenced by a reduction in uptake of the polyamine spermidine after treatment with CCCP [
21
]. CCCP
also reduces activity and blocks uptake of the human antifungal peptide histatin 5. Mitochondrial
petite mutants are also resistant to histatin 5, confirming the energy dependence of histatin 5
activity [42,43]
. Two distinct mechanisms of uptake have been observed for this peptide. The first
involves translocation of histatin 5 to the cytoplasm by the Dur3p and Dur31p polyamine transporters
in C. albicans [
21
,
42
]. The second involves endocytic uptake and sequestration into the vacuole,
with cells eventually undergoing vacuolar expansion and cell death. However, as deletion of genes
important for endocytosis or treatment with latrunculin A did not make the cells more sensitive to
histatin 5, vacuolar expansion was considered a secondary effect that does not contribute to toxicity [
42
].
This led to the hypothesis that CCCP induced resistance is due to the blockage of energy dependent
uptake through polyamine transporters. In this study, we discovered that uptake of fluorescently
labelled NaD1 into C. albicans cells was also reduced after addition of CCCP (Figure 3). This supported
our earlier work showing that NaD1 activity is reduced against S. cerevisiae rho (petite) mutants with
reduced mitochondrial function [
13
]. Combined, this data indicates that uptake of NaD1 is an energy
dependent process, such as endocytosis or movement through a polyamine transporter and is not due
to passive transport across the membrane.
J. Fungi 2018,4, 20 11 of 15
Polyamine transporters have been tested for a potential role in uptake of NaD1 into S. cerevisiae
cells [
44
]. Deletion of the polyamine transport regulator Agp2, which regulates the expression of
many genes, including the polyamine transporters Dur3 and Sam3 [
45
], reduced the antifungal activity
and uptake of NaD1 and reduced the activity of the antifungal peptides h
β
D2, CP29, BMAP-28 and
Bac2a [
44
]. Furthermore, addition of the polyamine, spermidine, protected S. cerevisiae against NaD1
induced membrane permeabilisation [
44
]. However, deletion of the polyamine transporters themselves
(sam3
, dur3
and sam3
dur3
) did not affect NaD1 activity. Thus it is not likely that NaD1 and the
other cationic peptides are internalised by a polyamine transporter, rather the reduction in spermidine
uptake leads to an accumulation of positively charged polyamines on the surface of yeast cells, which
in turn blocks access of positively charged antimicrobial peptides [
44
]. Given that NaD1 had bound to
the surface of the CCCP treated cells, it is unlikely that the decrease in the activity of NaD1 was due to
an accumulation of surface positive charges in these cells. Instead, the decrease in cell killing is likely
to be directly linked to the reduction in NaD1 uptake and supports the hypothesis that internalisation
of NaD1 into the fungal cytoplasm is an energy dependent process.
To confirm endocytosis as the mechanism of NaD1 uptake in C. albicans, cells were treated with
NaD1 in the presence of the endocytosis inhibitor latrunculin A, or at 4
C which reduces endocytic
uptake. Lowering the treatment temperature to 4
C did decrease NaD1 induced cell death and reduced
uptake of fluorescently labelled NaD1 into the cytoplasm of C. albicans cells (Figure 2). In contrast,
cell death induced by the human antimicrobial peptide LL-37 was not reduced when the temperature
was lowered to 4
C (Figure S1) This is consistent with a report by Ordonez and co-workers (2014),
in which they suggest that LL-37 killing arises from direct membrane permeabilisation and does
not involve endocytosis, because treatment with azide to reduce energy production failed to inhibit
LL-37 activity [
46
,
47
]. Similar to NaD1, the Penicillium antimicrobial peptide PAF also appears to be
internalised by endocytosis, because latrunculin B, which inhibits actin polymerisation like latrunculin
A, blocked PAF internalisation into Aspergillus nidulans hyphae [
18
]. In addition, PAF like NaD1 did
not enter cells in the presence of CCCP and PAF uptake was blocked at 4 C [18].
In another scenario, NaD1 may not be directly internalised by endocytosis but a target of NaD1
on the plasma membrane may require turnover or regulation by endocytosis. This occurs with the
ether-phospholipid edelfosine in S. cerevisiae. Edelfosine is internalised into S. cerevisiae cells but
not through endocytosis and its uptake is not required for toxicity. Instead, edelfosine functions by
inducing endocytic uptake of the plasma membrane H
+
pump Pma1p, which is transported to the
vacuole for degradation. Endocytosis mutants were less susceptible to edelfosine than wild type
cells, even though edelfosine uptake was not affected in these mutants. Instead, blocking endocytosis
had reduced antifungal activity by stopping internalisation of Pma1p [48]. In addition, mutants with
deletions of genes encoding proteins required for protein recycling and transport, including ESCRT
complexes, also enhanced resistance to edelfosine. Uptake and transport of edelfosine to the ER in
these mutants was also not altered and resistance in these mutants was attributed to higher levels of
Pma1p in the membrane due to decreased protein turnover [
48
]. As mutants in the ESCRT pathway
were not resistant to NaD1 (Table 1) it is unlikely that an unknown target protein in the membrane is
responsible for the NaD1 resistance that is generated by treatment with latrunculin A.
Endocytosis may not be the only mechanism by which NaD1 enters into cells. Latrunculin A
did not protect C. albicans from the deleterious effects of NaD1 when NaD1 was at concentrations
higher than 3.5
µ
M in a fungal inhibition assay (Figure 5). However, endocytosis may not have been
completely blocked in cells treated with latrunculin A and a limited amount of endocytosis at high
NaD1 concentrations may have been sufficient to internalise a lethal concentration of NaD1.
Alternatively, NaD1 at high concentrations may have directly damaged the plasma membrane
leading to cell death or transient lipid bilayer disruption which allowed entry of some NaD1 into the
cytoplasm. We have previously reported that NaD1 at high concentrations does partially penetrate
artificial phosphatidylinositol bilayers. Even though the resulting membrane disorder was reversible,
the association of NaD1 with the membrane may have been sufficient to allow small amounts of NaD1
J. Fungi 2018,4, 20 12 of 15
to come into contact with the phosphatidylinositol 4,5 bisphosphate (PI(4,5)P2) on the inner leaflet of
the membrane. Association of even small amounts of NaD1 with PI(4,5)P
2
bilayers results in tight
irreversible binding that produces severe disorder of the membrane and membrane disruption [
16
].
A similar mechanism may occur with histatin 5 at high concentrations. That is, energy depleted
C. albicans cells accumulate high levels of histatin 5 in their cell walls and are killed by histatin 5 via
direct interaction with the membrane [42].
Interestingly, El-Mounadi and co-workers [
15
] have reported that the mechanism of uptake of
the plant defensin MtDef4 varies between fungal species. Entry of MtDef4 into Neurospora crassa
cells is energy dependent and involves endocytosis. Consequently, uptake of MtDef4 into N. crassa is
abolished when ATP production is inhibited by sodium azide. Internalisation of MtDef4 is also reduced
by the endocytosis inhibitor filipin, which blocks lipid-raft mediated endocytosis [
15
]. In contrast,
MtDef4 uptake into Fusarium graminearum is only partially blocked by sodium azide and none of the
tested endocytosis inhibitors affected internalisation of the defensin. Instead, MtDef4 is hypothesised
to be internalised by translocation using a partially energy-dependent mechanism [
15
]. Therefore, it is
possible that uptake of NaD1 could occur through a different mechanism in different fungal species.
It is necessary to expand research into further species to confirm this.
Interestingly, treatment with latrunculin A did not affect MtDef4 uptake into N. crassa. In addition,
uptake ofMtDef4 was affected by brefeldin A [
15
]. These results are in direct contrast to observations
with NaD1 and indicate that these peptides are internalised by different forms of endocytosis. Unlike
MDef4, NaD1 movement through the cell does not appear dependent on the internal endosomal
system, also evidenced by the failure of nocodazole and the deletion of ESCRT components to alter
sensitivity to NaD1 (Figure 6, Table 1). This is consistent with the findings that while MtDef4 most likely
targets the vacuole of N. crassa hyphae [
15
], NaD1 does not appear to associate with any particular
organelle, instead diffusing through the entire cytoplasm [
12
]. It is not known how NaD1 escapes the
endocytic vesicles to access the cytoplasm.
Nonetheless, these observations further expand the model of NaD1’s mechanism of action.
NaD1 traverses the cell wall, accumulates on the cell surface and is then endocytosed through the
plasma membrane into the cytoplasm where it kills the fungal cell, possibly through production of
reactive oxygen species and by membrane disruption following binding of NaD1 to PI(4,5)P
2
on the
inner leaflet.
Supplementary Materials:
The following are available online at www.mdpi.com/2309- 608X/4/1/20/s1, Figure
S1: LL-37 induced cell death was not reduced when the temperature is lowered from 30 C to 4 C.
Acknowledgments:
This work was funded by Australian Research Council grants to MAA (DP160100309) and
MAA and NLV (DP150104386).
Author Contributions:
All authors contributed to the conception and design of experiments as well as data
analysis. Brigitte M. E. Hayes performed the experiments, analysed the data and wrote the manuscript. All authors
contributed to editing the manuscript.
Conflicts of Interest: The authors declare no conflict of interest.
References
1.
Fisher, M.C.; Henk, D.A.; Briggs, C.J.; Brownstein, J.S.; Madoff, L.C.; McCraw, S.L.; Gurr, S.J. Emerging
fungal threats to animal, plant and ecosystem health. Nature 2012,484, 186–194. [CrossRef] [PubMed]
2.
Strange, R.N.; Scott, P.R. Plant disease: A threat to global food security. Annu. Rev. Phytopathol.
2005
,43,
83–116. [CrossRef] [PubMed]
3.
Brown, G.D.; Denning, D.W.; Gow, N.A.R.; Levitz, S.M.; Netea, M.G.; White, T.C. Hidden killers: Human
fungal infections. Sci. Transl. Med. 2012,4, 165rv113. [CrossRef] [PubMed]
4.
Latge, J.P.; Calderone, R. Host-microbe interactions: Fungi invasive human fungal opportunistic infections.
Curr. Opin. Microbiol. 2002,5, 355–358. [CrossRef]
5.
Wanke, B.; Lazéra, M.D.S.; Nucci, M. Fungal infections in the immunocompromised host. Clin. Haematol.
2000,95, 153–158. [CrossRef]
J. Fungi 2018,4, 20 13 of 15
6.
Sanglard, D. Resistance of human fungal pathogens to antifungal drugs. Curr. Opin. Microbiol.
2002
,5,
379–385. [CrossRef]
7.
De Lucca, A.J.; Walsh, T.J. Antifungal peptides: Novel therapeutic compounds against emerging pathogens.
Antimicrob. Agents Chemother. 1999,43, 1–11. [PubMed]
8.
Jenssen, H.; Hamill, P.; Hancock, R.E. Peptide antimicrobial agents. Clin. Microbiol. Rev.
2006
,19, 491–511.
[CrossRef] [PubMed]
9.
Oren, Z.; Shai, Y. Mode of action of linear amphipathic
α
-helical antimicrobial peptides. Pept. Sci.
1998
,47,
451–463. [CrossRef]
10.
Nicolas, P. Multifunctional host defense peptides: Intracellular-targeting antimicrobial peptides. FEBS J.
2009,276, 6483–6496. [CrossRef] [PubMed]
11.
Lay, F.T.; Anderson, M.A. Defensins-Components of the innate immune system in plants. Curr. Protein Pept.
Sci. 2005,6, 85–101. [CrossRef] [PubMed]
12.
Van der Weerden, N.L.; Lay, F.T.; Anderson, M.A. The plant defensin, NaD1, enters the cytoplasm of Fusarium
oxysporum hyphae. J. Biol. Chem. 2008,283, 14445–14452. [CrossRef] [PubMed]
13.
Hayes, B.M.E.; Bleackley, M.R.; Wiltshire, J.L.; Anderson, M.A.; Traven, A.; van der Weerden, N.L.
Identification and mechanism of action of the plant defensin NaD1 as a new member of the antifungal drug
arsenal against Candida albicans.Antimicrob. Agents Chemother. 2013,57, 3667–3675. [CrossRef] [PubMed]
14.
Van der Weerden, N.L.; Hancock, R.E.W.; Anderson, M.A. Permeabilization of fungal hyphae by the plant
defensin NaD1 occurs through a cell wall-dependent process. J. Biol. Chem.
2010
,285, 37513–37520.
[CrossRef] [PubMed]
15.
El-Mounadi, K.; Islam, K.T.; Hernández-Ortiz, P.; Read, N.D.; Shah, D.M. Antifungal mechanisms of a
plant defensin MtDef4 are not conserved between the ascomycete fungi Neurospora crassa and Fusarium
graminearum.Mol. Microbiol. 2016,100, 542–559. [CrossRef] [PubMed]
16. Payne, J.A.E.; Bleackley, M.R.; Lee, T.-H.; Shafee, T.M.A.; Poon, I.K.H.; Hulett, M.D.; Aguilar, M.-I.; van der
Weerden, N.L.; Anderson, M.A. The plant defensin NaD1 introduces membrane disorder through a specific
interaction with the lipid, phosphatidylinositol 4,5 bisphosphate. BBA Biomembr.
2016
,1858, 1099–1109.
[CrossRef] [PubMed]
17.
Heytler, P.G.; Prichard, W.W. A new class of uncoupling agents—Carbonyl cyanide phenylhydrazones.
Biochem. Biophys. Res. Commun. 1962,7, 272–275. [CrossRef]
18.
Oberparleiter, C.; Kaiserer, L.; Haas, H.; Ladurner, P.; Andratsch, M.; Marx, F. Active internalization of the
Penicillium chrysogenum antifungal protein PAF in sensitive Aspergilli. Antimicrob. Agents Chemother.
2003
,
47, 3598–3601. [CrossRef] [PubMed]
19.
Ayscough, K.R.; Stryker, J.; Pokala, N.; Sanders, M.; Crews, P.; Drubin, D.G. High rates of actin filament
turnover in budding yeast and roles for actin in establishment and maintenance of cell polarity revealed
using the actin inhibitor latrunculin-A. J. Cell Biol. 1997,137, 399–416. [CrossRef] [PubMed]
20.
Dutta, D.; Donaldson, J.G. Search for inhibitors of endocytosis: Intended specificity and unintended
consequences. Cell. Logist. 2012,2, 203–208. [CrossRef] [PubMed]
21.
Kumar, R.; Chadha, S.; Saraswat, D.; Bajwa, J.S.; Li, R.A.; Conti, H.R.; Edgerton, M. Histatin 5 uptake
by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins. J. Biol. Chem.
2011
,286,
43748–43758. [CrossRef] [PubMed]
22.
Tati, S.; Jang, W.S.; Li, R.; Kumar, R.; Puri, S.; Edgerton, M. Histatin 5 resistance of Candida glabrata can
be reversed by insertion of Candida albicans polyamine transporter-encoding genes DUR3 and DUR31.
PLoS ONE 2013,8, e61480. [CrossRef] [PubMed]
23.
Deshayes, S.; Morris, M.C.; Divita, G.; Heitz, F. Cell-penetrating peptides: Tools for intracellular delivery of
therapeutics. Cell. Mol. Life Sci. 2005,62, 1839–1849. [CrossRef] [PubMed]
24.
Lindgren, M.E.; Hällbrink, M.M.; Elmquist, A.M.; Langel, U. Passage of cell-penetrating peptides across a
human epithelial cell layer in vitro. Biochem. J. 2004,377, 69–76. [CrossRef] [PubMed]
25. Fungal Genetics Stock Center. Available online: http://www.fgsc.net/.
26.
Davis, D.; Edwards, J.E.; Mitchell, A.P.; Ibrahim, A.S. Candida albicans RIM101 pH response pathway is
required for host-pathogen interactions. Infect. Immun. 2000,68, 5953–5959. [CrossRef] [PubMed]
27.
Davis, D.A.; Bruno, V.M.; Loza, L.; Filler, S.G.; Mitchell, A.P. Candida albicans Mds3p, a conserved regulator
of pH responses and virulence identified through insertional mutagenesis. Genetics
2002
,162, 1573–1581.
[PubMed]
J. Fungi 2018,4, 20 14 of 15
28.
Xu, W.; Smith, F.J.; Subaran, R.; Mitchell, A.P. Multivesicular body-ESCRT components function in pH
response regulation in Saccharomyces cerevisiae and Candida albicans.Mol. Biol. Cell
2004
,15, 5528–5537.
[CrossRef] [PubMed]
29.
Schindelin, J.; Arganda-Carreras, I.; Frise, E.; Kaynig, V.; Longair, M.; Pietzsch, T.; Preibisch, S.; Rueden, C.;
Saalfeld, S.; Schmid, B.; et al. Fiji: An open-source platform for biological-image analysis. Nat. Meth.
2012
,9,
676–682. [CrossRef] [PubMed]
30.
Broekaert, W.F.; Terras, F.R.G.; Cammue, B.P.A.; Vanderleyden, J. An automated quantitative assay for fungal
growth inhibition. FEMS Microbiol. Lett. 1990,69, 55–59. [CrossRef]
31.
Iacopetta, B.J.; Morgan, E.H. The kinetics of transferrin endocytosis and iron uptake from transferrin in
rabbit reticulocytes. J. Biol. Chem. 1983,258, 9108–9115. [PubMed]
32.
Munn, A.L. Molecular requirements for the internalisation step of endocytosis: Insights from yeast. BBA Mol.
Basis Dis. 2001,1535, 236–257. [CrossRef]
33.
Lippincott-Schwartz, J.; Yuan, L.; Tipper, C.; Amherdt, M.; Orci, L.; Klausner, R.D. Brefeldin A’s effects on
endosomes, lysosomes, and the TGN suggest a general mechanism for regulating organelle structure and
membrane traffic. Cell 1991,67, 601–616. [CrossRef]
34.
Wood, S.A.; Park, J.E.; Brown, W.J. Brefeldin A causes a microtubule-mediated fusion of the trans-Golgi
network and early endosomes. Cell 1991,67, 591–600. [CrossRef]
35.
Apodaca, G. Endocytic traffic in polarized epithelial cells: Role of the actin and microtubule cytoskeleton.
Traffic 2001,2, 149–159. [CrossRef] [PubMed]
36.
Matteoni, R.; Kreis, T.E. Translocation and clustering of endosomes and lysosomes depends on microtubules.
J. Biol. Chem. 1987,105, 1253–1265. [CrossRef]
37.
Henne, W.M.; Buchkovich, N.J.; Emr, S.D. The ESCRT pathway. Dev. Cell
2011
,21, 77–91. [CrossRef]
[PubMed]
38.
Saksena, S.; Sun, J.; Chu, T.; Emr, S.D. ESCRTing proteins in the endocytic pathway. Trends Biochem. Sci.
2007
,
32, 561–573. [CrossRef] [PubMed]
39.
Lobo, D.S.; Pereira, I.B.; Fragel-Madeira, L.; Medeiros, L.N.; Cabral, L.M.; Faria, J.; Bellio, M.; Campos, R.C.;
Linden, R.; Kurtenbach, E. Antifungal Pisum sativum defensin 1 interacts with Neurospora crassa cyclin F
related to the cell cycle. Biochemistry 2007,46, 987–996. [CrossRef] [PubMed]
40.
Sagaram, U.S.; El-Mounadi, K.; Buchko, G.W.; Berg, H.R.; Kaur, J.; Pandurangi, R.S.; Smith, T.J.; Shah, D.M.
Structural and functional studies of a phosphatidic acid-binding antifungal plant defensin MtDef4:
Identification of an RGFRRR motif governing fungal cell entry. PLoS ONE
2013
,8, e82485. [CrossRef]
[PubMed]
41.
Cools, T.L.; Vriens, K.; Struyfs, C.; Verbandt, S.; Ramada, M.H.S.; Brand, G.D.; Bloch, C.; Koch, B.; Traven, A.;
Drijfhout, J.W.; et al. The antifungal plant defensin HsAFP1 is a phosphatidic acid-interacting peptide
inducing membrane permeabilization. Front. Microbiol. 2017,8. [CrossRef] [PubMed]
42.
Jang, W.S.; Bajwa, J.S.; Sun, J.N.; Edgerton, M. Salivary histatin 5 internalization by translocation, but
not endocytosis, is required for fungicidal activity in Candida albicans.Mol. Microbiol.
2010
,77, 354–370.
[CrossRef] [PubMed]
43.
Gyurko, C.; Lendenmann, U.; Troxler, R.F.; Oppenheim, F.G. Candida albicans mutants deficient in respiration
are resistant to the small cationic salivary antimicrobial peptide histatin 5. Antimicrob. Agents Chemother.
2000,44, 348–354. [CrossRef] [PubMed]
44.
Bleackley, M.R.; Wiltshire, J.L.; Perrine-Walker, F.; Vasa, S.; Burns, R.L.; van der Weerden, N.L.;
Anderson, M.A. Agp2p, the plasma membrane transregulator of polyamine uptake, regulates the antifungal
activities of the plant defensin NaD1 and other cationic peptides. Antimicrob. Agents Chemother.
2014
,58,
2688–2698. [CrossRef] [PubMed]
45.
Aouida, M.; Texeira, M.R.; Thevelein, J.M.; Poulin, R.; Ramotar, D. Agp2, a member of the yeast amino
acid permease family, positively regulates polyamine transport at the transcriptional level. PLoS ONE
2013
,
8, e65717. [CrossRef]
46.
Ordonez, S.R.; Amarullah, I.H.; Wubbolts, R.W.; Veldhuizen, E.J.A.; Haagsman, H.P. Fungicidal mechanisms
of cathelicidins LL-37 and CATH-2 revealed by live-cell imaging. Antimicrob. Agents Chemother.
2014
,58,
2240–2248. [CrossRef] [PubMed]
J. Fungi 2018,4, 20 15 of 15
47.
Den Hertog, A.; van Marle, J.; van Veen, H.; van’t Hof, W.; Bolscher, J.; Veerman, E.; Nieuw Amerongen, A.
Candidacidal effects of two antimicrobial peptides: Histatin 5 causes small membrane defects, but LL-37
causes massive disruption of the cell membrane. Biochem. J. 2005,388, 689–695. [CrossRef] [PubMed]
48.
Cuesta-Marbán, Á.; Botet, J.; Czyz, O.; Cacharro, L.M.; Gajate, C.; Hornillos, V.; Delgado, J.; Zhang, H.;
Amat-Guerri, F.; Acuña, A.U.; et al. Drug uptake, lipid rafts, and vesicle trafficking modulate resistance to
an anticancer lysophosphatidylcholine analogue in yeast. J. Biol. Chem.
2013
,288, 8405–8418. [CrossRef]
[PubMed]
©
2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access
article distributed under the terms and conditions of the Creative Commons Attribution
(CC BY) license (http://creativecommons.org/licenses/by/4.0/).
... X-ray crystallographic analysis showed that the β2-β3 loop was important for lipid binding, and mutagenesis studies confirmed this finding with mutants of proposed key lipid-binding residues showing reduced efficacy against fungal cells [13]. Lipid binding also plays a role in defensin oligomerisation and complex formation, which has been proposed as a key event in the membrane permeabilising activity of some defensins [14,16,20,23]. Intriguingly, the NaD1-PA crystal structure reveals an oligomeric structure, termed the membrane disruption complex (MDC). ...
... Images generated using PyMOL. internalisation), NaD1-induced cell death was significantly reduced [23]. Additionally, MtDef4 uptake into Neurospora crassa and Fusarium graminearum was significantly reduced following cold or sodium azide treatment both of which block ATP synthesis required for energy dependant internalisation [24]. ...
... Additionally, MtDef4 uptake into Neurospora crassa and Fusarium graminearum was significantly reduced following cold or sodium azide treatment both of which block ATP synthesis required for energy dependant internalisation [24]. These studies suggest that defensins require both active uptake into the cytoplasm and intracellular targeting for their membrane rupturing effect [23,24]. It is worth noting that in some cases such as in tumour cells where membrane asymmetry is often disrupted, defensins may also be able to act on the outer leaflet of the membrane in addition to the requirement for internalisation [25]. ...
Article
Full-text available
Defensins are a class of host defence peptides (HDPs) that often harbour antimicrobial and anticancer activities, making them attractive candidates as novel therapeutics. In comparison with current antimicrobial and cancer treatments, defensins uniquely target specific membrane lipids via mechanisms distinct from other HDPs. Therefore, defensins could be potentially developed as therapeutics with increased selectivity and reduced susceptibility to the resistance mechanisms of tumour cells and infectious pathogens. In this review, we highlight recent advances in defensin research with a particular focus on membrane lipid-targeting in cancer and infection settings. In doing so, we discuss strategies to harness lipid-binding defensins for anticancer and anti-infective therapies.
... There is compelling evidence that defensins can induce ROS accumulation within the targeted fungal cells. This has been notably demonstrated for RsAFP2 in C. albicans [160,161], for NaD1 in C. albicans [162,163] or in F. oxysporum [150] and for HsAFP1 in C. albicans [164]. It should be noted that internalization is not required for inducing ROS production as RsAFP2, which is not internalized, induces the production of ROS [161]. ...
... According to previous works, MtDef4 internalization in N. crassa could be related to endocytosis. Similarly, NaD1 has been reported to bind to a putative cell wall receptor of C. albicans and to be taken up to the cytoplasm through endocytosis, causing cytoplasm granulation [150,163]. In fact, the mechanism of non-lytic defensin internalization remains poorly understood [135]. ...
Article
Full-text available
Crops are threatened by numerous fungal diseases that can adversely affect the availability and quality of agricultural commodities. In addition, some of these fungal phytopathogens have the capacity to produce mycotoxins that pose a serious health threat to humans and livestock. To facilitate the transition towards sustainable environmentally friendly agriculture, there is an urgent need to develop innovative methods allowing a reduced use of synthetic fungicides while guaranteeing optimal yields and the safety of the harvests. Several defensins have been reported to display antifungal and even—despite being under-studied—antimycotoxin activities and could be promising natural molecules for the development of control strategies. This review analyses pioneering and recent work addressing the bioactivity of defensins towards fungal phytopathogens; the details of approximately 100 active defensins and defensin-like peptides occurring in plants, mammals, fungi and invertebrates are listed. Moreover, the multi-faceted mechanism of action employed by defensins, the opportunity to optimize large-scale production procedures such as their solubility, stability and toxicity to plants and mammals are discussed. Overall, the knowledge gathered within the present review strongly supports the bright future held by defensin-based plant protection solutions while pointing out the obstacles that still need to be overcome to translate defensin-based in vitro research findings into commercial products.
... benthamiana Niben101Scf01052g01004.1), AtD90 (Arabidopsis thaliana, AT3G05727), AtD212 (A. thaliana, AT3G5730), CrD26 (Capsella rubella, Carubv10014946), and SlD26 (Solanum lycopersicum, Solyc07g009230) were ordered from Genscript (Piscataway, NJ, USA) that were codon optimized for expression in yeast. The coding sequences of the mature peptides, lacking the predicted signal peptide, were amplified by PCR using primers and cloned into the pPink-alpha-HC vector for expression in the Pichia pastoris pPINK system as described in [21] using the primers listed in Table S1. This expression system adds an additional Alanine residue to the N-terminus. ...
... The antifungal activity of the HRDs was assessed against the agricultural pathogen Fusarium graminearum isolate PH-1 and the human pathogen Candida albicans strain ATCC90028. Antifungal assays and fungal culture were performed as described in [23] and [21] for F. graminearum and C. albicans, respectively. ...
Article
Full-text available
Plant defensins are best known for their antifungal activity and contribution to the plant immune system. The defining feature of plant defensins is their three-dimensional structure known as the cysteine stabilized alpha-beta motif. This protein fold is remarkably tolerant to sequence variation with only the eight cysteines that contribute to the stabilizing disulfide bonds absolutely conserved across the family. Mature defensins are typically 46–50 amino acids in length and are enriched in lysine and/or arginine residues. Examination of a database of approximately 1200 defensin sequences revealed a subset of defensin sequences that were extended in length and were enriched in histidine residues leading to their classification as histidine-rich defensins (HRDs). Using these initial HRD sequences as a query, a search of the available sequence databases identified over 750 HRDs in solanaceous plants and 20 in brassicas. Histidine residues are known to contribute to metal binding functions in proteins leading to the hypothesis that HRDs would have metal binding properties. A selection of the HRD sequences were recombinantly expressed and purified and their antifungal and metal binding activity was characterized. Of the four HRDs that were successfully expressed all displayed some level of metal binding and two of four had antifungal activity. Structural characterization of the other HRDs identified a novel pattern of disulfide linkages in one of the HRDs that is predicted to also occur in HRDs with similar cysteine spacing. Metal binding by HRDs represents a specialization of the plant defensin fold outside of antifungal activity.
... Synthetic NmDef02 (monomer) also showed no activity (unpublished results). Other plant defensins, such as NaD1, require a dimeric conformation to show antifungal antiviral activity (Hayes et al. 2018(Hayes et al. , 2013Lay et al. 2019;Poon et al. 2014). The structure of NmDef02 is unknown but considered to be a defensin, based on molecular modeling predictions (Fig. 1c) and its primary structure, which contains eight cysteines that probably form four disulfide bridges. ...
Article
Full-text available
Antibiotic resistance.is one of the biggest challenges sciences faces today. It is extremely urgent to develop new antimicrobial compounds to control infections in the "post-antibiotic era”. Plant defensins belong to a large family of small cationic antimicrobial peptides and are an integral part of the innate immune system of plants. The gene coding for the mature peptide NmDef02 (isolated from Nicotiana megalosiphon) was cloned into a pSMT3 vector, generating the plasmid pSMT3-DEF02, used to express the protein SUMO-NmDef02 in Escherichia coli, strain Shuffle T7 Express lysY. The soluble chimeric protein was purified by Ni–NTA affinity chromatography and cleaved by the UPL1 protease. The sample was re-applied to a Ni–NTA and approximately 20 mg of NmDef02 was obtained from the fermentation of 1 L of E. coli culture. The purified proteins were analyzed by SDS-PAGE under reduction condition and its identity was confirmed by Western blotting, using anti-histidine and anti-NmDef02 antibodies. NmDef02 defensin showed antimicrobial activity against plant and human pathogens. The recombinant fusion strategy could be an approach to produce bioactive recombinant NmDef02.
... In N. crassa, the internalization of MtDef4 depends on the presence of phospholipase D, whereas this is not the case in Fusarium graminearum (Sagaram et al., 2011;El-Mounadi et al., 2016). The uptake of AMPs is often an active, energy requiring process, pointing to endocytosis as in case of HsAFP1, histatin 5, MtDef4, NaD1, NFAP, and PAF (Figures 2A,C,D,F; Oberparleiter et al., 2003;Jang et al., 2010;Kumar et al., 2011;Puri and Edgerton, 2014;El-Mounadi et al., 2016;Cools et al., 2017b;Hayes et al., 2018;Hajdu et al., 2019). Indeed, in N. crassa, internalization of MtDef4 is energy dependent and requires endocytosis, while in F. graminearum, uptake is only partially energy dependent (El-Mounadi et al., 2016). ...
Article
Full-text available
The incidence of invasive fungal infections is increasing worldwide, resulting in more than 1.6 million deaths every year. Due to growing antifungal drug resistance and the limited number of currently used antimycotics, there is a clear need for novel antifungal strategies. In this context, great potential is attributed to antimicrobial peptides (AMPs) that are part of the innate immune system of organisms. These peptides are known for their broad-spectrum activity that can be directed toward bacteria, fungi, viruses, and/or even cancer cells. Some AMPs act via rapid physical disruption of microbial cell membranes at high concentrations causing cell leakage and cell death. However, more complex mechanisms are also observed, such as interaction with specific lipids, production of reactive oxygen species, programmed cell death, and autophagy. This review summarizes the structure and mode of action of antifungal AMPs, thereby focusing on their interaction with fungal membranes.
... At present, transcriptomic and proteomic methods in plant AMP research are important and widely introduced [31][32][33]. Despite this, AMP isolation is still of relevance in investigations of structure-function relationships of AMPs at the cellular and organism levels, when the substance is required as it is [34][35][36]. Some new peptides that are still not involved in the actual plant AMP classification [4] have been isolated by the classical approach through extraction from plants [7,28]. ...
Article
Full-text available
Plants are good sources of biologically active compounds with antimicrobial activity, including polypeptides. Antimi-crobial peptides (AMPs) represent one of the main barriers of plant innate immunity to environmental stress factors and are attracting much research interest. There are some extraction methods for isolation of AMPs from plant organs based on the type of extractant and initial fractionation stages. But most methods are directed to obtain some specific structural types of AMPs and do not allow to understand the molecular diversity of AMP inside a whole plant. In this mini-review, we suggest an optimized scheme of AMP isolation from plants followed by obtaining a set of peptides belonging to various structural families. This approach can be performed for large-scale screening of plants to identify some novel or homologous AMPs for fundamental and applied studies.
Article
Candida albicans is the principal opportunistic fungal pathogen in nosocomial settings and resistance to antifungal drugs is on the rise. Antimicrobial peptides from natural sources are promising novel therapeutics against C. albicans. OsDef2 defensin was previously found to be active against only Gram‐positive bacteria, whereas derived fragments Os and its cysteine‐free analogue, Os‐C, are active against Gram‐positive and Gram‐negative bacteria at low micromolar concentrations. In this study, OsDef2‐derived analogues and fragments were screened for anticandidal activity with the aim to identify peptides with antifungal activity and in so doing obtain a better understanding of the structural requirements for activity and modes of action. Os, Os‐C and Os(11–22)NH2, a Os‐truncated carboxy‐terminal‐amidated fragment, had the most significant antifungal activities, with minimum fungicidal concentrations (MFCs) in the micromolar range (6–28 μM). C. albicans killing was rapid and occurred within 30–60 min. Further investigations showed all three peptides interacted with cell wall derived polysaccharides while both Os and Os(11–22)NH2 permeabilized fungal liposomes. Confocal laser scanning microscopy confirmed that Os‐C and Os(11–22)NH2 could enter the cytosol of live cells and subsequent findings suggest that the uptake of Os and Os‐C, in contrast to Os(11–22)NH2, is energy dependent. Although Os, Os‐C and Os(11–22)NH2 induced the production of reactive oxygen species (ROS), co‐incubation with ascorbic acid revealed that only ROS generated by Os‐C and to a lesser extent Os(11–22)NH2 resulted in cell death. Overall, Os, Os‐C and Os(11–22)NH2 are promising candidacidal agents. C‐terminal derivative of OsDef2, Os and shorter derivatives Os‐C and Os(11–22)NH2 are active against Candida albicans.
Thesis
Les champignons phytopathogènes sont la principale cause de maladies chez les plantes cultivées. Botrytis cinerea est un champignon nécrotrophe, responsable de la pourriture grise, ciblant de nombreuses cultures d’intérêt agronomique (tomate, vigne, fraise). La lutte contre ce pathogène intègre la recherche de nouvelles solutions antifongiques dérivées de molécules naturelles telles que les peptides antimicrobiens (PAMs). Le peptide ETD151 est un PAM exclusivement antifongique optimisé à partir de l’héliomicine, une défensine d’insecte isolée chez le papillon Heliothis virescens. Ce petit peptide cationique, riche en cystéine et non-cytotoxique démontre une activité in vitro prometteuse sur les champignons phytopathogènes dont B. cinerea. Ces travaux de thèse ont visé par des approches pluridisciplinaires (protéomique, sphingolipidomique, microscopie confocale) à une meilleure compréhension du mécanisme d’action du peptide ETD151, dans le but éventuel de développer une nouvelle stratégie de protection des cultures. Dans un premier temps, des études protéomiques de type « bottom-up » ont été conduites sur du mycélium de B. cinerea en présence ou absence du peptide. L’analyse différentielle des résultats a permis d’identifier des protéines et des voies métaboliques, telle que la chaîne respiratoire, impactées par l’ETD151. Dans un second temps et en s’appuyant sur sa forte homologie avec l’héliomicine, nous avons démontré le rôle prépondérant de certains lipides membranaires appelés glucosylcéramides dans l’activité de l’ETD151. Deux formes de ces lipides, Bc-GlcCer-2 et Bc GlcCer-3, ont été caractérisées par spectrométrie de masse chez B. cinerea et permettent d’expliquer la sensibilité du champignon au peptide antifongique. Ces résultats ont guidé les études d’interaction protéine-lipide par RMN actuellement en cours. Enfin, nous avons pu définir l’ETD151 comme une défensine morphogénique chez B. cinerea, à l’instar de certaines défensines antifongiques d’insectes et de plantes. En effet, le peptide inhibe la germination des spores et l’élongation des hyphes tout en modifiant la morphologie du champignon. Il perturbe également l’intégrité membranaire et aboutit à la libération du contenu intracellulaire, de façon non mécanique et sans agir directement sur la voie contrôlant l’osmorégulation. Par conjugaison avec le fluorophore BODIPY, nous avons révélé une affinité particulière de l’EDT151 pour l’enveloppe cellulaire et son internalisation
Article
Full-text available
Disease-causing fungi pose a serious threat to human health and food safety and security. The limited number of licensed antifungals, together with the emergence of pathogenic fungi with multiple resistance to available antifungals, represents a serious challenge for medicine and agriculture. Therefore, there is an urgent need for new compounds with high fungal specificity and novel antifungal mechanisms. Antifungal proteins in general, and AfpB from Penicillium digitatum in particular, are promising molecules for the development of novel antifungals. This study on AfpB’s mode of action demonstrates its potent, specific fungicidal activity through the interaction with multiple targets, presumably reducing the risk of evolving fungal resistance, and through a regulated cell death process, uncovering this protein as an excellent candidate for a novel biofungicide. The in-depth knowledge on AfpB mechanistic function presented in this work is important to guide its possible future clinical and agricultural applications.
Article
Full-text available
We describe a cysteine-rich, membrane-penetrating, joint-targeting and remarkably stable peptide, EgK5, that modulates voltage-gated KV1.3 potassium channels in T lymphocytes by a distinctive mechanism. EgK5 enters plasma membranes and binds to KV1.3, causing current rundown by a phosphatidylinositol 4,5-bisphosphate-dependent mechanism. EgK5 exhibits selectivity for KV1.3 over other channels, receptors, transporters and enzymes. EgK5 suppresses antigen-triggered proliferation of effector memory T cells, a subset enriched amongst pathogenic autoreactive T cells in autoimmune disease. PET-CT imaging with 18F-labeled EgK5 shows accumulation of the peptide in large and small joints of rodents. In keeping with its arthrotropism, EgK5 treats disease in a rat model of rheumatoid dermatitis. It was also effective in treating disease in a rat model of atopic dermatitis. No signs of toxicity are observed at 10-100 times the in vivo dose. EgK5 shows promise for clinical development as a therapeutic for autoimmune diseases.
Article
Full-text available
HsAFP1, a plant defensin isolated from coral bells (Heuchera sanguinea), is characterized by broad-spectrum antifungal activity. Previous studies indicated that HsAFP1 binds to specific fungal membrane components, which had hitherto not been identified, and induces mitochondrial dysfunction and cell membrane permeabilization. In this study, we show that HsAFP1 reversibly interacts with the membrane phospholipid phosphatidic acid (PA), which is a precursor for the biosynthesis of other phospholipids, and to a lesser extent with various phosphatidyl inositol phosphates (PtdInsP’s). Moreover, via reverse ELISA assays we identified two basic amino acids in HsAFP1, namely histidine at position 32 and arginine at position 52, as well as the phosphate group in PA as important features enabling this interaction. Using a HsAFP1 variant, lacking both amino acids (HsAFP1[H32A][R52A]), we showed that, as compared to the native peptide, the ability of this variant to bind to PA and PtdInsP’s is reduced (≥74%) and the antifungal activity of the variant is reduced (≥2-fold), highlighting the link between PA/PtdInsP binding and antifungal activity. Using fluorescently labelled HsAFP1 in confocal microscopy and flow cytometry assays, we showed that HsAFP1 accumulates at the cell surface of yeast cells with intact membranes, most notably at the buds and septa. The resulting HsAFP1-induced membrane permeabilization is likely to occur after HsAFP1’s internalization. These data provide novel mechanistic insights in the mode of action of the HsAFP1 plant defensin.
Article
Full-text available
Defensins play an important role in plant defense against fungal pathogens. The plant defensin, MtDef4, inhibits growth of the ascomycete fungi, Neurospora crassa and Fusarium graminearum, at micromolar concentrations. We have reported that MtDef4 is transported into the cytoplasm of these fungi and exerts its antifungal activity on intracellular targets. Here, we have investigated whether the antifungal mechanisms of MtDef4 are conserved in these fungi. We show that N. crassa and F. graminearum respond differently to MtDef4 challenge. Membrane permeabilization is required for the antifungal activity of MtDef4 against F. graminearum but not against N. crassa. We find that MtDef4 is targeted to different subcellular compartments in each fungus. Internalization of MtDef4 in N. crassa is energy-dependent and involves endocytosis. By contrast, MtDef4 appears to translocate into F. graminearum autonomously using a partially energy-dependent pathway. MtDef4 has been shown to bind to the phospholipid phosphatidic acid (PA). We provide evidence that the plasma membrane localized phospholipase D, involved in the biosynthesis of PA, is needed for entry of this defensin in N. crassa, but not in F. graminearum. To our knowledge, this is the first example of a defensin which inhibits the growth of two ascomycete fungi via different mechanisms. This article is protected by copyright. All rights reserved.
Article
Full-text available
Cationic antifungal peptides (AFPs) act through a variety of mechanisms but share the common feature of interacting with the fungal cell surface. NaD1, a defensin from Nicotiana alata, has potent antifungal activity against a variety of fungi of both hyphal and yeast morphologies. The mechanism of action of NaD1 occurs via three steps: binding to the fungal cell surface, permeabilization of the plasma membrane, and internalization and interaction with intracellular targets to induce fungal cell death. The targets at each of these three stages have yet to be defined. In this study, the screening of a Saccharomyces cerevisiae deletion collection led to the identification of Agp2p as a regulator of the potency of NaD1. Agp2p is a plasma membrane protein that regulates the transport of polyamines and other molecules, many of which carry a positive charge. Cells lacking the agp2 gene were more resistant to NaD1, and this resistance was accompanied by a decreased uptake of defensin. Agp2p senses and regulates the uptake of the polyamine spermidine, and competitive inhibition of the antifungal activity of NaD1 by spermidine was observed in both S. cerevisiae and the plant pathogen Fusarium oxysporum. The resistance of agp2Δ cells to other cationic antifungal peptides and decreased binding of the cationic protein cytochrome c to agp2Δ cells compared to that of wild-type cells have led to a proposed mechanism of resistance whereby the deletion of agp2 leads to an increase in positively charged molecules at the cell surface that repels cationic antifungal peptides.
Article
Full-text available
Antifungal mechanisms of action of two cathelicidins, chicken CATH-2 and human LL-37, were studied and compared with the mode of action of the salivary peptide histatin 5 (Hst5). Candida albicans was used as a model organism for fungal pathogens. Analysis by live-cell imaging showed that the peptides kill C. albicans rapidly. CATH-2 is the most active peptide and kills C. albicans within 5 min. Both cathelicidins induce cell membrane permeabilization and simultaneous vacuolar expansion. Minimal fungicidal concentrations (MFC) are in the same order of magnitude for all three peptides, but the mechanisms of antifungal activity are very different. The activity of cathelicidins is independent of the energy status of the fungal cell, unlike Hst5 activity. Live-cell imaging using fluorescently labeled peptides showed that both CATH-2 and LL-37 quickly localize to the C. albicans cell membrane, while Hst5 was mainly directed to the fungal vacuole. Small amounts of cathelicidins internalize at sub-MFCs, suggesting that intracellular activities of the peptide could contribute to the antifungal activity. Analysis by flow cytometry indicated that CATH-2 significantly decreases C. albicans cell size. Finally, electron microscopy showed that CATH-2 affects the integrity of the cell membrane and nuclear envelope. It is concluded that the general mechanisms of action of both cathelicidins are partially similar (but very different from that of Hst5). CATH-2 has unique features and possesses antifungal potential superior to that of LL-37.
Article
Full-text available
MtDef4 is a 47-amino acid cysteine-rich evolutionary conserved defensin from a model legume Medicago truncatula. It is an apoplast-localized plant defense protein that inhibits the growth of the ascomycetous fungal pathogen Fusarium graminearum in vitro at micromolar concentrations. Little is known about the mechanisms by which MtDef4 mediates its antifungal activity. In this study, we show that MtDef4 rapidly permeabilizes fungal plasma membrane and is internalized by the fungal cells where it accumulates in the cytoplasm. Furthermore, analysis of the structure of MtDef4 reveals the presence of a positively charged γ-core motif composed of β2 and β3 strands connected by a positively charged RGFRRR loop. Replacement of the RGFRRR sequence with AAAARR or RGFRAA abolishes the ability of MtDef4 to enter fungal cells, suggesting that the RGFRRR loop is a translocation signal required for the internalization of the protein. MtDef4 binds to phosphatidic acid (PA), a precursor for the biosynthesis of membrane phospholipids and a signaling lipid known to recruit cytosolic proteins to membranes. Amino acid substitutions in the RGFRRR sequence which abolish the ability of MtDef4 to enter fungal cells also impair its ability to bind PA. These findings suggest that MtDef4 is a novel antifungal plant defensin capable of entering into fungal cells and affecting intracellular targets and that these processes are mediated by the highly conserved cationic RGFRRR loop via its interaction with PA.
Article
Full-text available
Agp2 is a plasma membrane protein of the Saccharomyces cerevisiae amino acid transporter family, involved in high-affinity uptake of various substrates including L-carnitine and polyamines. The discovery of two high affinity polyamine permeases, Dur3 and Sam3, prompted us to investigate whether Agp2 directly transports polyamines or acts instead as a regulator. Herein, we show that neither dur3Δ nor sam3Δ single mutant is defective in polyamine transport, while the dur3Δ sam3Δ double mutant exhibits a sharp decrease in polyamine uptake and an increased resistance to polyamine toxicity similar to the agp2Δ mutant. Studies of Agp2 localization indicate that in the double mutant dur3Δ sam3Δ, Agp2-GFP remains plasma membrane-localized, even though transport of polyamines is strongly reduced. We further demonstrate that Agp2 controls the expression of several transporter genes including DUR3 and SAM3, the carnitine transporter HNM1 and several hexose, nucleoside and vitamin permease genes, in addition to SKY1 encoding a SR kinase that positively regulates low-affinity polyamine uptake. Furthermore, gene expression analysis clearly suggests that Agp2 is a strong positive regulator of additional biological processes. Collectively, our data suggest that Agp2 might respond to environmental cues and thus regulate the expression of several genes including those involved in polyamine transport.
Article
Full-text available
In recent decades, pathogenic fungi have become a serious threat to human health, leading to major efforts aimed at characterizing new agents for improved treatments. Promising in this context are antimicrobial peptides produced by animals and plants as part of innate immune systems. Here, we describe an antifungal defensin, NaD1, with activity against the major human pathogen Candida albicans, characterize the mechanism of killing, and identify protection strategies used by the fungus to survive defensin treatment. The mechanism involves interaction between NaD1 and the fungal cell surface followed by membrane permeabilization, entry into the cytoplasm, hyperproduction of reactive oxygen species, and killing induced by oxidative damage. By screening C. albicans mutant libraries, we identified that the high-osmolarity glycerol (HOG) pathway has a unique role in protection against NaD1, while several other stress-responsive pathways are dispensable. The involvement of the HOG pathway is consistent with induction of oxidative stress by NaD1. The HOG pathway has been reported to have a major role in protection of fungi against osmotic stress, but our data indicate that osmotic stress does not contribute significantly to the adverse effects of NaD1 on C. albicans. Our data, together with previous studies with human beta-defensins and salivary histatin 5, indicate that inhibition of the HOG pathway holds promise as a broad strategy for increasing the activity of antimicrobial peptides against C. albicans.
Article
Full-text available
Candida albicans and Candida glabrata are predominant fungi associated with oral candidiasis. Histatin 5 (Hst 5) is a small cationic human salivary peptide with high fungicidal activity against C. albicans, however many strains of C. glabrata are resistant. Since Hst 5 requires fungal binding to cell wall components prior to intracellular translocation, reduced Hst 5 binding to C. glabrata may be the reason for its insensitivity. C. glabrata has higher surface levels of β-1,3-glucans as compared with C. albicans; however these differences did not account for reduced Hst 5 uptake and killing in C. glabrata. Similarly, the biofilm matrix of C. glabrata contained significantly higher levels of β-1,3-glucans compared with C. albicans, but it did not reduce the percentage of Hst 5 positive fungal cells in the biofilm. Hst 5 enters C. albicans cell through polyamine transporters Dur3p and Dur31p that are uncharacterized in C. glabrata. C. glabrata strains expressing CaDur3 and CaDur31 had two-fold higher killing and uptake of Hst 5. Thus, neither C. glabrata cell surface or biofilm matrix β-1,3-glucan levels affected Hst 5 toxicity; rather the crucial rate limiting step is reduced uptake that can be overcome by expression of C. albicans Dur proteins in C. glabrata.
Article
The increasing resistance of bacteria to conventional antibiotics resulted in a strong effort to develop antimicrobial compounds with new mechanisms of action. Antimicrobial peptides seem to be a promising solution to this problem. Many studies aimed at understanding their mode of action were described in the past few years. The most studied group includes the linear, mostly α-helical peptides. Although the exact mechanism by which they kill bacteria is not clearly understood, it has been shown that peptide–lipid interactions leading to membrane permeation play a role in their activity. Membrane permeation by amphipathic α-helical peptides can proceed via either one of the two mechanisms: (a) transmembrane pore formation via a “barrel-stave” mechanism; and (b) membrane destruction/solubilization via a “carpet-like” mechanism. The purpose of this review is to summarize recent studies aimed at understanding the mode of action of linear α-helical antimicrobial peptides. This review, which is focused on magainins, cecropins, and dermaseptins as representatives of the amphipathic α-helical antimicrobial peptides, supports the carpet-like rather the barrel-stave mechanism. That these peptides vary with regard to their length, amino acid composition, and net positive charge, but act via a common mechanism, may imply that other linear antimicrobial peptides that share the same properties also share the same mechanism. © 1999 John Wiley & Sons, Inc. Biopoly 47: 451–463, 1998
Article
Plant defensins interact with phospholipids in bilayers as part of their cytotoxic activity. Solanaceous class II defensins with the loop 5 sequence pattern "S-[KR]-[ILVQ]-[ILVQ]-[KR]-[KR]" interact with PI(4,5)P2. Here, the prototypical defensin of this class, NaD1, is used to characterize the biophysical interactions between these defensins and phospholipid bilayers. Binding of NaD1 to bilayers containing PI(4,5)P2 occurs rapidly and the interaction is very strong. Dual polarization interferometry revealed that NaD1 does not dissociate from bilayers containing PI(4,5)P2. Binding of NaD1 to bilayers with or without PI(4,5)P2 induced disorder in the bilayer. However, permeabilisation assays revealed that NaD1 only permeabilised liposomes with PI(4,5)P2 in the bilayer, suggesting a role for this protein-lipid interaction in the plasma membrane permeabilising activity of this defensin. No defensins in the available databases were identified to have the PI(4,5)P2 binding sequence outside the solanaceous class II defensins, leading to the hypothesis that PI(4,5)P2 binding co-evolved with the C-terminal propeptide to protect the host cell against the effects of the tight binding of these defensins to their cognate lipid as they travel along the secretory pathway. This data has allowed us to develop a new model to explain how this class of defensins permeabilises plasma membranes to kill target cells.