The Plant Defensin NaD1 Enters the Cytoplasm of Candida Albicans via Endocytosis

Abstract

Antimicrobial peptides are widespread in nature and are produced by many organisms as a first line of defence against pathogens. These peptides have a broad range of biological activities, such as antibacterial or antifungal activities and act with varied mechanisms of action. A large number of the peptides are amphipathic α-helices which act by disrupting plasma membranes and allowing leakage of intracellular contents. However, some peptides have more complex mechanisms of action that require internalisation into the target organisms' cytoplasm. The method by which these peptides enter the cytoplasm varies, with some requiring the energy dependent processes of endocytosis or polyamine transport and others entering via passive transport. Here we describe the mechanism that the antimicrobial peptide, the plant defensin NaD1, uses to transverse the fungal membrane and gain access to the fungal cytoplasm. By inhibiting ATP synthesis and using an inhibitor of actin polymerisation, we show that NaD1 is internalised into C. albicans yeast cells by the energy-dependent process of endocytosis.

Full text

Fungi
Journal of
Article
The Plant Defensin NaD1 Enters the Cytoplasm of
Candida albicans via Endocytosis
Brigitte M. E. Hayes, Mark R. Bleackley, Marilyn A. Anderson and Nicole L. van der Weerden *
La Trobe Institute for Molecular Science, La Trobe University, 3086 Melbourne, Australia;
B.Hayes@latrobe.edu.au (B.M.E.H.); m.bleackley@latrobe.edu.au (M.R.B.);
M.Anderson@latrobe.edu.au (M.A.A.)
*Correspondence: N.VanDerWeerden@latrobe.edu.au
Received: 30 December 2017; Accepted: 3 February 2018; Published: 6 February 2018
Abstract:
Antimicrobial peptides are widespread in nature and are produced by many organisms as
a first line of defence against pathogens. These peptides have a broad range of biological activities,
such as antibacterial or antifungal activities and act with varied mechanisms of action. A large
number of the peptides are amphipathic
α
-helices which act by disrupting plasma membranes and
allowing leakage of intracellular contents. However, some peptides have more complex mechanisms
of action that require internalisation into the target organisms’ cytoplasm. The method by which
these peptides enter the cytoplasm varies, with some requiring the energy dependent processes of
endocytosis or polyamine transport and others entering via passive transport. Here we describe the
mechanism that the antimicrobial peptide, the plant defensin NaD1, uses to transverse the fungal
membrane and gain access to the fungal cytoplasm. By inhibiting ATP synthesis and using an
inhibitor of actin polymerisation, we show that NaD1 is internalised into C. albicans yeast cells by the
energy-dependent process of endocytosis.
Keywords: fungi; antifungal peptides; plant defensin; endocytosis; Candida albicans
1. Introduction
Fungal disease is an increasing problem affecting both agriculture and human health [
1
,
2
].
With increasing incidence of human disease, particularly in immunocompromised individuals and
the emergence of resistance to the current antifungal therapies [
3
–
6
], antimicrobial peptides are an
attractive alternative method of treatment [
7
]. Antimicrobial peptides are innate immunity molecules
produced by all organisms including plants, animals and insects [
8
]. Antimicrobial peptides are
typically small, cationic molecules and many form amphipathic
α
-helices which act by binding to and
disrupting lipid bilayers [
8
,
9
]. However, there are also more complex antifungal peptides that do more
than simply disrupting membranes [10].
One such group of peptides is the plant defensins, many of which are potent antifungal
molecules [
11
]. We have previously described the plant defensin NaD1, from ornamental tobacco,
which has potent activity against both agricultural and human pathogens [
12
,
13
]. The mechanism of
action of NaD1 is complex. Firstly, it interacts with components of the fungal cell wall [
14
]. The peptide
then enters the cytoplasm and reactive oxygen species are produced [
12
,
13
]. The plasma membrane
is then permeabilised and cell death occurs. Similarly, another plant defensin MtDef4 from the
model legume Medicago tranculata enters the Fusarium graminearum cytoplasm before membrane
permeabilisation and cell death [
15
]. We have hypothesised that permeabilisation of the membrane
after NaD1 treatment is a result of interaction with phosphatidylinositol 4,5 bisphosphate (PI(4,5)P
2
)
on the inner leaflet of the membrane. NaD1 binds to PI(4,5)P
2
on lipid strips and can permeabilise
PI(4,5)P
2
containing liposomes [
16
]. However, the mechanism by which NaD1 gains access to the
cytoplasm has not been elucidated.
J. Fungi 2018,4, 20; doi:10.3390/jof4010020 www.mdpi.com/journal/jof

J. Fungi 2018,4, 20 2 of 15
Different mechanisms have been described for passage of antimicrobial peptides through the
plasma membrane, including endocytosis, polyamine transporters and passive transport. For example,
the Penicillium antimicrobial peptide PAF is internalised by endocytosis. This was revealed when PAF
did not enter cells that had been treated with carbonyl cyanide m-chlorophenyl hydrazone (CCCP),
an uncoupler of oxidative phosphorylation [
17
], or cells maintained at 4
◦
C indicating that energy is
required for PAF uptake [
18
]. In addition, inhibition of actin polymerisation, which is required for
endocytosis in yeast [
19
,
20
] blocks PAF internalisation into Aspergillus nidulans hyphae [
18
]. Similarly,
uptake of the plant defensin MtDef4 into Neurospora crassa hyphae is reduced at 4
◦
C and was abolished
when ATP production was blocked with sodium azide. Uptake of this defensin was also reduced
in N. crassa cells after treatment with brefeldin A, which blocks retrograde transport and filipin,
an inhibitor of lipid raft dependent endocytosis [15].
Polyamine transporters also function in the uptake of cationic peptides. For example, the human
antifungal peptide, histatin 5, enters C. albicans cells via the polyamine transporters Dur3p and
Dur31p. Deletion of these transporters reduces histatin 5’s antifungal activity [
21
] and expression of
the transporters in a histatin 5 resistant Candida glabrata strain renders them sensitive to the peptide [
22
].
In addition, when the polyamines spermidine or spermine were added to C. albicans along with histatin
5, cells were more resistant to the peptide. Furthermore, uptake of FITC labelled histatin 5 into
C. albicans was blocked by addition of spermidine [
21
]. Like PAF, CCCP, the uncoupler of oxidative
phosphorylation, also blocks the antifungal activity of histatin 5, although in this instance it is likely
due to impairment of the energy requirement of the polyamine transporter, as CCCP also blocks the
uptake of spermidine into C. albicans cells [21].
Passive transport is the mode of entry of certain cell-penetrating peptides (CPPs) in accessing
the cytoplasm. These peptides are small (less than 30 amino acids long) and positively charged [
23
].
One such CPP is the synthetic peptide transportan, a 27 residue variant of the peptide galparan,
which was derived by fusion of the neuropeptide, galanin, with the wasp venom peptide,
mastoparan [
24
]. Passage of this peptide across the plasma membrane and entry into the cytoplasm
is likely to occur via direct penetration, as uptake is not inhibited by low temperatures (4
◦
C), nor is
it blocked by phenylarsine oxide, an inhibitor of clathrin-mediated endocytosis, phagocytosis and
macropinocytosis [20,23,24].
In this study, we investigated the mechanism by which the plant defensin NaD1 enters the
cytoplasm of C. albicans cells. We show that NaD1 uptake is essential for killing and that uptake
occurs through the energy dependent process of endocytosis. Furthermore, we show that a secondary
method of killing that does not require endocytosis may occur at higher NaD1 concentrations and
that once internalised, NaD1 does not require the cell’s internal protein transport machinery to have
antifungal activity.
2. Materials and Methods
2.1. Protein Source
NaD1 was purified from the flowers of Nicotiana alata as described in
van der Weerden et al.
(2008) [
12
]. In brief, flowers were crushed in a mortar and pestle with liquid nitrogen and
then subjected to an acid and heat treatment. Protein was then purified using cation-exchange
chromatography and reverse-phase high-performance liquid chromatography (RP-HPLC).
The protein concentration was determined using the bicinchoninic acid (BCA) protein assay
(ThermoFisher, Scoresby, Australia). NaD1 was fluorescently labelled with 4,4-Difluoro-5,7-Dimethyl-
4-Bora-3a,4a-Diaza-s-Indacene-3-Propionyl Ethylenediamine, Hydrochloride (BODIPY-FL-EDA, Life
Technologies, Carlsbad, CA, USA) as described in [
13
]. The LL-37 peptide (amino acid sequence:
[LL-37, 37 aa]) was synthesised by GenScript (Piscataway,
NJ, USA).

J. Fungi 2018,4, 20 3 of 15
2.2. Fungal Strains
All C. albicans strains were obtained from the fungal genetic stock centre [
25
] and are described
in [
26
–
28
]. Strains were derived from the BWP17 background strain (ura3::imm434/ura3::imm434
iro1/iro1::imm434 his1::hisG/his1::hisG arg4/arg4). The DAY185 wild-type C. albicans strain (ARG4+,
URA3+, HIS1+) was used in most assays. For testing of C. albicans ESCRT mutants, DAY286 (ARG4+,
URA3+, his1-) was used as the wild-type strain. C. albicans ESCRT (ARG4+, URA3+, his1-) mutants
were produced by transposon insertion [
28
]. Strains were grown in yeast extract-peptone dextrose
(YPD) at 30
◦
C with shaking (250 rpm). For C. albicans mutant strains, YPD was supplemented with
80 µg/mL uridine.
2.3. Confocal Microscopy
C. albicans DAY185 overnight cultures were diluted in half-strength potato dextrose broth (PDB;
Becton Dickinson, Scoresby, Australia) to an OD
600
of 0.2 and grown for a further three hours (30
◦
C,
250 rpm). Cells were then diluted to an OD
600
of 0.3 with half-strength PDB. For time course
experiments, 300
µ
L aliquots (in 1.5 mL microcentrifuge tubes) were pre-treated with 5
µ
M propidium
iodide (PI; Sigma, St Louis, MO, USA) for 10 min prior to addition of BODIPY- labelled NaD1.
For CCCP and latrunculin A experiments, yeast cells were pre-treated with 50
µ
M CCCP (Sigma) or
100
µ
M latrunculin A (AdipoGen, Liestal, Switzerland) for 2 h (30
◦
C, 250 rpm) before addition of 5
µ
M
PI. BODIPY-NaD1 (10
µ
M) was then added and cells were monitored using a Zeiss LSM510/ConfoCor
confocal with images taken every 5 sec. BODIPY was excited at 488 nm (Argon laser) and emission
was detected at 505 to 530 nm. PI was excited at 561 nm (DPSS laser) and fluorescence was monitored
at 575 to 615 nm. Images were captured using Zen2009 (Zeiss, Oberkochen, Germany) software and
analysed using FIJI (Bethesda, Rockville, MD, USA) [
29
]. Brightness and contrast for Figures 1,3and 4
were adjusted using the auto-brightness/contrast function of FIJI.
2.4. Flow Cytometry
C. albicans DAY185 overnight cultures were diluted in half-strength potato dextrose broth (PDB)
to an OD
600
of 0.2 and grown for 3 h (30
◦
C, 250 rpm) before they were diluted again to an OD
600
of
0.1 with half-strength PDB and used in cell death and NaD1 uptake assays. Cell death assays were
conducted by treating 300
µ
L of C. albicans cells with 0, 5, 10 or 20
µ
M of native NaD1 or LL-37 and 5
µ
M
PI. NaD1 uptake at 4
◦
C was measured by treating 300
µ
L of cells with 0, 5 or 10
µ
M BODIPY-labelled
NaD1. All treatments were conducted for 30 min at either 30
◦
C or 4
◦
C without shaking and in the
dark. For brefeldin A and nocodazole experiments, 300
µ
L of cells were pre-incubated with 40
µ
M of
each inhibitor for 2 h at 30
◦
C (with shaking). Cells were then treated with 10
µ
M of BODIPY-NaD1 for
15 min. For all experiments, cells were pelleted after treatment by centrifugation at 13,000 rpm for 2 min.
The supernatant was removed and cells were resuspended in 300
µ
L of 1
×
phosphate buffered saline
(PBS) before analysis using a BD FACSCanto II cytometer (Scoresby, Australia). For BODIPY-labelled
NaD1, cells were excited at 488 nm and emission was detected using a 530/30 filter. For PI, cells were
excited at 488 nm and emission was detected using a 670LP filter. Data were analysed using Weasel
v3.0 (Walter and Eliza Hall Institute, Parkville, Australia).
2.5. Growth Inhibition Assays
Fungal growth inhibition assays were performed essentially as described in [
30
]. Overnight
cultures of C. albicans cells were diluted to 5000 cells/mL with half-strength PDB. For growth inhibition
assays in the presence of latrunculin A, 80
µ
L of diluted C. albicans DAY185 cells were added to 10
µ
L of
latrunculin A and 10
µ
L of NaD1 in a 96 well microtiter plate (Greiner, Kremsmünster, Austria) to final
concentrations of 2.5, 3, 4 and 4.5
µ
M NaD1 and 0 or 20
µ
M latrunculin A (AdipoGen). For brefeldin
A and nocodazole assays, 80
µ
L of diluted C. albicans DAY185 cells was added to 10
µ
L of inhibitor
and 10
µ
L of NaD1 in a microtiter plate. Brefeldin A (Sigma) and nocodazole where serially diluted

J. Fungi 2018,4, 20 4 of 15
(two-fold) down the plate with top final concentrations of 40
µ
M and 20
µ
M respectively. NaD1
was added to all wells at a final concentration of 2.5
µ
M. No-inhibitor controls were also included.
For testing the antifungal activity of NaD1 against the C. albicans ESCRT mutants, 80
µ
L of diluted
cells (DAY286 wild type and mutants) were added to 20
µ
L of NaD1 serially diluted from a top final
concentration of 10
µ
M. All plates were incubated at 30
◦
C overnight without shaking. Growth of cells
was monitored by measuring absorbance at 595 nm in a SpectraMAX M5e plate reader (Molecular
Devices, San Jose, CA, USA). Measurements were taken at t= 0 and t= 24 h.
3. Results
3.1. NaD1 Uptake into C. albicans Cells Occurs in Three Stages
We have previously described the three step mechanism of action of NaD1 against fungi, which
involves binding to the cell surface, internalisation of the peptide into the cytoplasm and induction
of reactive oxygen species (ROS) [
12
,
13
]. To further investigate the timing of these steps, confocal
microscopy time-course experiments were performed using fluorescently labelled NaD1 and the
death marker PI. A time-course of the uptake of BODIPY-NaD1 into two individual cells is shown
(Figure 1A). In the first cell (left panel), BODIPY-NaD1 is bound to the cell surface and there is no
visible PI fluorescence. At 45 sec, BODIPY-NaD1 had started to enter the cytoplasm and a small amount
of PI fluorescence was observed. The appearance of the cell did not change for an additional 65 s (110 s
time-point), at which time the BODIPY-NaD1 had filled the cytoplasm. Over the following time period,
PI fluorescence increased until it levelled off at 330 sec. A similar sequence of events occurred with the
second cell (right panel). The median delay between accumulation of NaD1 on the cell surface and
uptake into the cytoplasm was 4 min (Figure 1B). The time between the first appearance of NaD1 in
the cytoplasm and peak fluorescence in the cytoplasm had a median of 0.67 min (Figure 1C).
3.2. NaD1’s Antifungal Activity and Uptake into Fungal Cells is Reduced at 4 ◦C and after Treatment
with CCCP
At 4
◦
C, endocytosis and other active cellular processes are blocked [
31
,
32
]. To determine if uptake
of NaD1 into fungal cells is an energy dependent process, C. albicans DAY185 cells were treated with
native NaD1 (with PI to monitor cell death), or with BODIPY-labelled NaD1 at 30
◦
C or 4
◦
C and uptake
into yeast cells was monitored by flow cytometry. There was less cell death when cells were treated
with NaD1 for 30 min at 4
◦
C compared to 30
◦
C (Figure 2Ai,Aii). In contrast, cell death following
treatment with the human cathelicidin LL-37 was not affected by the reduced temperature (Figure S1).
To determine if the reduction in cell death at 4
◦
C had arisen from a decrease in NaD1 uptake into
the cytoplasm, the flow cytometry experiment was repeated with fluorescently labelled NaD1. Fewer
cells contained BODIPY-labelled NaD1 in the cytoplasm after incubation at 4
◦
C compared to 30
◦
C
(Figure 2Bi,Bii). This points towards an energy dependent method of uptake, such as endocytosis,
as the mechanism by which NaD1 enters C. albicans cells.
An inhibitor of oxidative phosphorylation, CCCP, was used to confirm that the uptake mechanism
of NaD1 is energy dependent. As expected, there was a decrease in BODIPY-labelled NaD1 uptake
and cell death (monitored by PI fluorescence) when cells were rendered energy deficient with a 50
µ
M
CCCP pre-treatment (Figure 3A). Interestingly, CCCP treatment also increased the proportion of cells
with BODIPY-labelled NaD1 on the cell surface. In the absence of CCCP, about 55% of cells had
internalised NaD1 and about 21% of cells had accumulated BODIPY-labelled NaD1 on the cell surface.
In contrast, about 20% of the CCCP pre-treated cells had NaD1 in the cytoplasm and about 50% of cells
had NaD1 restricted to the cell surface (Figure 3B). These data indicate that cell surface binding is not
affected by CCCP pre-treatment. However, passage through the plasma membrane requires energy,
as evidenced by the reduction in NaD1 uptake and the resulting increase in the number of cells with
NaD1 trapped at the cell surface.

J. Fungi 2018,4, 20 5 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 5 of 14
Figure 1. BODIPY-NaD1 uptake occurs in three steps. C. albicans DAY185 was treated with 10 µM
BODIPY-NaD1 and 5 µM PI and imaged every 5 s with a confocal microscope. (A) Each panel shows
a C. albicans cell at four time-points. Each panel shows the first instance of the described phenotype.
White light, BODIPY-NaD1 and PI images are shown for each time point. At the first time-point
BODIPY-NaD1 is present on the cell surface. The second time-point shows the moment that BODIPY-
NaD1 and PI enter the cytoplasm. By the third time-point the BODIPY-NaD1 has filled the entire
cytoplasm. At the last time-point PI accumulation levels off. Scale bars = 5 µM. Images are a
representative example of three independent experiments, which gave equivalent results. Cells
shown were chosen at random; (B) A box-and-whisker plot showing the time delay (in min) from the
moment BODIPY-NaD1 is visible on the cell surface to when it first enters the cytoplasm for 70
individual cells. Three independent experiments were performed and a single field of view was
analysed for each biological replicate. All cells that were applicable (i.e., had not yet accumulated
NaD1 on the cell surface) were analysed and the frames counted between when BODIPY-NaD1 was
first observed bound to the cell surface and when uptake occurred; (C) A box-and-whisker plot
showing the time delay (in min) from the moment BODIPY-NaD1 first enters the cytoplasm to the
moment the entire cytoplasm is fluorescent for 95 individual cells. Three independent experiments
were performed and a single field of view was analysed for each biological replicate. All cells that
were applicable (i.e., had not yet internalised NaD1) were analysed and the frames counted between
when uptake first occurred to when NaD1 filled the entire cytoplasm.
Figure 1.
BODIPY-NaD1 uptake occurs in three steps. C. albicans DAY185 was treated with 10
µ
M
BODIPY-NaD1 and 5
µ
M PI and imaged every 5 s with a confocal microscope. (
A
) Each panel
shows a C. albicans cell at four time-points. Each panel shows the first instance of the described
phenotype. White light, BODIPY-NaD1 and PI images are shown for each time point. At the first
time-point BODIPY-NaD1 is present on the cell surface. The second time-point shows the moment that
BODIPY-NaD1 and PI enter the cytoplasm. By the third time-point the BODIPY-NaD1 has filled the
entire cytoplasm. At the last time-point PI accumulation levels off. Scale bars = 5
µ
M. Images are a
representative example of three independent experiments, which gave equivalent results. Cells shown
were chosen at random; (
B
) A box-and-whisker plot showing the time delay (in min) from the moment
BODIPY-NaD1 is visible on the cell surface to when it first enters the cytoplasm for 70 individual
cells. Three independent experiments were performed and a single field of view was analysed for
each biological replicate. All cells that were applicable (i.e., had not yet accumulated NaD1 on the
cell surface) were analysed and the frames counted between when BODIPY-NaD1 was first observed
bound to the cell surface and when uptake occurred; (
C
) A box-and-whisker plot showing the time
delay (in min) from the moment BODIPY-NaD1 first enters the cytoplasm to the moment the entire
cytoplasm is fluorescent for 95 individual cells. Three independent experiments were performed and a
single field of view was analysed for each biological replicate. All cells that were applicable (i.e., had
not yet internalised NaD1) were analysed and the frames counted between when uptake first occurred
to when NaD1 filled the entire cytoplasm.

J. Fungi 2018,4, 20 6 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 6 of 14
Figure 2. NaD1 induced cell death and uptake is reduced at 4 °C. (Ai) C. albicans DAY185 was treated
with 0, 5 or 10 µM NaD1 for 30 min at 30° and 4 °C. PI (5 µM) was added for quantitation of cell death.
Cells with PI fluorescence were counted using a flow cytometer to separate living and dead cells at
both 30 °C (grey shading) and 4 °C (black line). Data is a representative example from three
independent experiments; (Aii) The percentage of PI positive cells (percent cell death) relative to total
cell counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the means. Values marked by an asterisk are significant (using an independent
t-test) compared to the 30 °C control (p-value < 0.05); (Bi) C. albicans DAY185 was treated with 0, 5 or
10 µM BODIPY-NaD1 for 30 min at 30° and 4 °C. Cells with BODIPY fluorescence were counted using
a flow cytometer and separated to determine the relative numbers of cells that had or had not taken
up BODIPY-NaD1 at 30 °C (grey shading) or 4 °C (black line). Data is a representative example from
three independent experiments; (Bii) The percentage of BODIPY-NaD1 positive cells relative to total
cells counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the mean. Values marked by an asterisk are significant (using an independent t-
test) compared to the 30 °C control (p-value < 0.05).
Figure 2.
NaD1 induced cell death and uptake is reduced at 4
◦
C. (
Ai
)C. albicans DAY185 was treated
with 0, 5 or 10
µ
M NaD1 for 30 min at 30
◦
and 4
◦
C. PI (5
µ
M) was added for quantitation of cell
death. Cells with PI fluorescence were counted using a flow cytometer to separate living and dead
cells at both 30
◦
C (grey shading) and 4
◦
C (black line). Data is a representative example from three
independent experiments; (
Aii
) The percentage of PI positive cells (percent cell death) relative to total
cell counts was also calculated for three biological replicates and is shown in a bar graph. Error bars
are standard error of the means. Values marked by an asterisk are significant (using an independent
t-test) compared to the 30
◦
C control (p-value < 0.05); (
Bi
)C. albicans DAY185 was treated with 0, 5 or
10
µ
M BODIPY-NaD1 for 30 min at 30
◦
and 4
◦
C. Cells with BODIPY fluorescence were counted using
a flow cytometer and separated to determine the relative numbers of cells that had or had not taken up
BODIPY-NaD1 at 30
◦
C (grey shading) or 4
◦
C (black line). Data is a representative example from three
independent experiments; (
Bii
) The percentage of BODIPY-NaD1 positive cells relative to total cells
counts was also calculated for three biological replicates and is shown in a bar graph. Error bars are
standard error of the mean. Values marked by an asterisk are significant (using an independent t-test)
compared to the 30 ◦C control (p-value < 0.05).

J. Fungi 2018,4, 20 7 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 7 of 14
Figure 3. NaD1 uptake is reduced after treatment with CCCP. (A) Confocal microscopy was used to
monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with CCCP. CCCP pre-
treated cells (50 µM CCCP) and no-inhibitor control (0 µM CCCP) cells were treated with 10 µM
BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images are shown. Scale bars = 40
µm. A subset of cells is also shown with increased magnification. Scale bars = 40 µm. Images are a
representative example of three independent experiments, which gave equivalent results. (B) Cell
counts were performed for four independent experiments and the percentage of BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error bars
are standard error of the mean (n = 4). Values marked by an asterisk are significant (using an
independent t-test) compared to the 0 µM CCCP control (p-value < 0.05).
3.3. NaD1 Uptake and NaD1 Induced Cell Death are Reduced in the Presence of the Actin Assembly
Inhibitor Latrunculin A
Having confirmed that uptake of NaD1 into C. albicans cells is an energy dependent process, we
questioned whether this uptake occurs via endocytosis. This was achieved by pre-treating C. albicans
cells with the inhibitor latrunculin A which blocks actin polymerisation into filaments, a step which
is essential for endocytosis in yeast [19,20]. After C. albicans cells were pre-treated for 2 h with 100 µM
latrunculin A, uptake of BODIPY-labelled NaD1 was significantly reduced, with approximately 20%
of cells containing NaD1 in the cytoplasm after 10 min of NaD1 treatment compared to about 40% of
cells in the no-inhibitor control (Figure 4). As with CCCP pre-treatment, there was an increase in the
number of cells with NaD1 bound to the cell surface. NaD1 was still bound to the fungal cell surface
but internalisation of the peptide was blocked, leaving a higher proportion of cells with surface
bound NaD1.
Figure 3.
NaD1 uptake is reduced after treatment with CCCP. (
A
) Confocal microscopy was used
to monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with CCCP. CCCP
pre-treated cells (50
µ
M CCCP) and no-inhibitor control (0
µ
M CCCP) cells were treated with 10
µ
M
BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images are shown.
Scale bars = 40 µm
.
A subset of cells is also shown with increased magnification. Scale bars = 40
µ
m. Images are a
representative example of three independent experiments, which gave equivalent results. (
B
) Cell
counts were performed for four independent experiments and the percentage of BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error
bars are standard error of the mean (n= 4). Values marked by an asterisk are significant (using an
independent t-test) compared to the 0 µM CCCP control (p-value < 0.05).
3.3. NaD1 Uptake and NaD1 Induced Cell Death are Reduced in the Presence of the Actin Assembly Inhibitor
Latrunculin A
Having confirmed that uptake of NaD1 into C. albicans cells is an energy dependent process, we
questioned whether this uptake occurs via endocytosis. This was achieved by pre-treating C. albicans
cells with the inhibitor latrunculin A which blocks actin polymerisation into filaments, a step which is
essential for endocytosis in yeast [
19
,
20
]. After C. albicans cells were pre-treated for 2 h with 100
µ
M
latrunculin A, uptake of BODIPY-labelled NaD1 was significantly reduced, with approximately 20%
of cells containing NaD1 in the cytoplasm after 10 min of NaD1 treatment compared to about 40%
of cells in the no-inhibitor control (Figure 4). As with CCCP pre-treatment, there was an increase in
the number of cells with NaD1 bound to the cell surface. NaD1 was still bound to the fungal cell
surface but internalisation of the peptide was blocked, leaving a higher proportion of cells with surface
bound NaD1.

J. Fungi 2018,4, 20 8 of 15
We also investigated whether latrunculin A blocked uptake when NaD1 was more concentrated.
In this assay, C. albicans cells were treated concurrently with 20
µ
M latrunculin A and increasing
amounts of NaD1. Lower concentrations of NaD1 were tested in this assay to account for lower
starting cell densities used in the fungal inhibition assays. We have previously published data
showing that increased cell densities require increased NaD1 concentrations to have a similar level
of activity [
13
]. Growth inhibition by 2.5
µ
M NaD1 (which is close to the IC
50
value of 2.3
±
0.6
µ
M
against C. albicans DAY185 previously reported [
13
]) was reduced in the presence of 20
µ
M latrunculin
A (Figure 5). However, latrunculin A did not protect the C. albicans cells when the NaD1 concentration
was increased to 4
µ
M. Thus, endocytosis appears to be the dominant mechanism of NaD1 uptake
at lower concentrations but uptake via endocytosis is not be required for cell death at higher NaD1
concentrations (concentrations higher than the IC50 value).
J. Fungi 2018, 4, x FOR PEER REVIEW 8 of 14
We also investigated whether latrunculin A blocked uptake when NaD1 was more concentrated.
In this assay, C. albicans cells were treated concurrently with 20 µM latrunculin A and increasing
amounts of NaD1. Lower concentrations of NaD1 were tested in this assay to account for lower
starting cell densities used in the fungal inhibition assays. We have previously published data
showing that increased cell densities require increased NaD1 concentrations to have a similar level
of activity [13]. Growth inhibition by 2.5 µM NaD1 (which is close to the IC50 value of 2.3 ± 0.6 µM
against C. albicans DAY185 previously reported [13]) was reduced in the presence of 20 µM
latrunculin A (Figure 5). However, latrunculin A did not protect the C. albicans cells when the NaD1
concentration was increased to 4 µM. Thus, endocytosis appears to be the dominant mechanism of
NaD1 uptake at lower concentrations but uptake via endocytosis is not be required for cell death at
higher NaD1 concentrations (concentrations higher than the IC50 value).
Figure 4. NaD1 uptake is reduced after treatment with latrunculin A. (A) Confocal microscopy was
used to monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with latrunculin
A. Latrunculin A pre-treated cells (100 µM latrunculin A) and no-inhibitor control (0 µM latrunculin
A) cells were treated with 10 µM BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light
images are shown. A subset of cells is also shown with increased magnification. Scale bars = 40 µm.
Images are a representative example of three independent experiments, which gave equivalent
results; (B) Cells counts were performed for three independent microscopy experiments and percent
BODIPY-labelled NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell
counts. Error bars are standard error of the mean (n = 3). Values marked by an asterisk are significant
(using an independent t-test) compared to the 0 µM latrunculin A control (p-value < 0.05).
Figure 4.
NaD1 uptake is reduced after treatment with latrunculin A. (
A
) Confocal microscopy was
used to monitor uptake of BODIPY-NaD1 into C. albicans DAY185 after pre-treatment with latrunculin
A. Latrunculin A pre-treated cells (100
µ
M latrunculin A) and no-inhibitor control (0
µ
M latrunculin A)
cells were treated with 10
µ
M BODIPY-NaD1 for 10 min. BODIPY-NaD1 and PI and white light images
are shown. A subset of cells is also shown with increased magnification.
Scale bars = 40 µm
. Images
are a representative example of three independent experiments, which gave equivalent results; (
B
) Cells
counts were performed for three independent microscopy experiments and percent BODIPY-labelled
NaD1 bound to the membrane or in the cytoplasm was plotted relative to total cell counts. Error bars are
standard error of the mean (n= 3). Values marked by an asterisk are significant (using an independent
t-test) compared to the 0 µM latrunculin A control (p-value < 0.05).

J. Fungi 2018,4, 20 9 of 15
J. Fungi 2018, 4, x FOR PEER REVIEW 9 of 14
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans. C. albicans DAY185
was treated with 20 µM latrunculin A only, NaD1 only or 20 µM latrunculin A and NaD1 in
combination. NaD1 was included at 2.5, 3, 3.5 and 4 µM. Data are relative to the 20 µM latrunculin A
only control. Error bars represent standard error of the mean (n = 3). Values marked by an asterisk are
significantly different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor
brefeldin A blocks retrograde transport from endosomes to the trans-Golgi network [33,34], while
nocodazole causes depolarization of microtubules leading to defects in endosome movement [35,36].
No significant difference was observed in the growth of C. albicans DAY185 cells when they were
treated with these two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway,
which is responsible for endosome trafficking and formation of late endosomes (or MVBs) [37,38],
did not reduce NaD1’s antifungal activity compared to C. albicans DAY286 wild type (Table 1). This
indicates that retrograde transport is not essential for the activity of NaD1.
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5 µM NaD1 only, inhibitors only or 2.5 µM NaD1 and (Ai) 20 µM brefeldin
A or (Bi) 20 µM nocodazole in combination. Data are relative to the inhibitor only controls. Error bars
represent SEM (n = 3). No values were significantly different (using an independent t-test) to the NaD1
only control (p-value > 0.05). C. albicans DAY185 was treated with 10 µM BODIPY-NaD1 for 15 min
with (Aii) 40 µM brefeldin A or (Bii) 40 µM nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans.C. albicans DAY185
was treated with 20
µ
M latrunculin A only, NaD1 only or 20
µ
M latrunculin A and NaD1 in combination.
NaD1 was included at 2.5, 3, 3.5 and 4
µ
M. Data are relative to the 20
µ
M latrunculin A only control.
Error bars represent standard error of the mean (n= 3). Values marked by an asterisk are significantly
different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor brefeldin
A blocks retrograde transport from endosomes to the trans-Golgi network [
33
,
34
], while nocodazole
causes depolarization of microtubules leading to defects in endosome movement [
35
,
36
]. No significant
difference was observed in the growth of C. albicans DAY185 cells when they were treated with these
two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway, which is responsible
for endosome trafficking and formation of late endosomes (or MVBs) [
37
,
38
], did not reduce NaD1’s
antifungal activity compared to C. albicans DAY286 wild type (Table 1). This indicates that retrograde
transport is not essential for the activity of NaD1.
J. Fungi 2018, 4, x FOR PEER REVIEW 9 of 14
Figure 5.
Latrunculin A reduces the inhibitory activity of NaD1 against C. albicans. C. albicans DAY185
was treated with 20 µM latrunculin A only, NaD1 only or 20 µM latrunculin A and NaD1 in
combination. NaD1 was included at 2.5, 3, 3.5 and 4 µM. Data are relative to the 20 µM latrunculin A
only control. Error bars represent standard error of the mean (n = 3). Values marked by an asterisk are
significantly different (using an independent t-test) to the NaD1 only control (p-value < 0.05).
3.4. Internal Protein Transport Is not Required for NaD1 Activity
Once extracellular molecules are internalised by endocytosis, they are transported intracellularly
via endosomes. Two inhibitors of endosomal transport were tested in fungal inhibition assays to
determine whether endosomal trafficking is critical for NaD1 antifungal activity. The inhibitor
brefeldin A blocks retrograde transport from endosomes to the trans-Golgi network [33,34], while
nocodazole causes depolarization of microtubules leading to defects in endosome movement [35,36].
No significant difference was observed in the growth of C. albicans DAY185 cells when they were
treated with these two inhibitors (Figure 6). Likewise, deletion of components of the ESCRT pathway,
which is responsible for endosome trafficking and formation of late endosomes (or MVBs) [37,38],
did not reduce NaD1’s antifungal activity compared to C. albicans DAY286 wild type (Table 1). This
indicates that retrograde transport is not essential for the activity of NaD1.
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5 µM NaD1 only, inhibitors only or 2.5 µM NaD1 and (Ai) 20 µM brefeldin
A or (Bi) 20 µM nocodazole in combination. Data are relative to the inhibitor only controls. Error bars
represent SEM (n = 3). No values were significantly different (using an independent t-test) to the NaD1
only control (p-value > 0.05). C. albicans DAY185 was treated with 10 µM BODIPY-NaD1 for 15 min
with (Aii) 40 µM brefeldin A or (Bii) 40 µM nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).
Figure 6. Brefeldin A and nocodazole do not affect the activity of NaD1 against C. albicans. C. albicans
DAY185 was treated with 2.5
µ
M NaD1 only, inhibitors only or 2.5
µ
M NaD1 and (
Ai
) 20
µ
M brefeldin
A or (
Bi
) 20
µ
M nocodazole in combination. Data are relative to the inhibitor only controls. Error
bars represent SEM (n= 3). No values were significantly different (using an independent t-test) to the
NaD1 only control (p-value > 0.05). C. albicans DAY185 was treated with 10
µ
M BODIPY-NaD1 for
15 min with (
Aii
) 40
µ
M brefeldin A or (
Bii
) 40
µ
M nocodazole. Cells with BODIPY fluorescence were
counted using a flow cytometer and separated to determine the percentage of cells that had taken up
the BODIPY-NaD1 in the presence (black line) and absence of inhibitors (grey shading).

J. Fungi 2018,4, 20 10 of 15
Table 1. Deletion of ESCRT pathway components does not affect activity of NaD1.
IC50 (µM)
Wild type (DAY286) vps2∆vps23∆vps24∆vps28∆vps36∆snf7∆bro1∆
1.8 ±0.49 1.8 ±0.40 1.8 ±0.43 2.1 ±0.33 1.6 ±0.33 1.7 ±0.28 1.9 ±0.45 2.1 ±0.35
C. albicans DAY286 (WT), vps2
∆
,vps23
∆
,vps24
∆
,vps28
∆
,vps36
∆
,snf7
∆
and bro1
∆
were treated with various
concentrations of NaD1. IC50
±
standard deviation of C. albicans ESCRT mutants treated with NaD1 are shown
(n= 4). No values were significantly (using an independent t-test) different from wild-type (p> 0.05).
4. Discussion
Plant defensins are a large family of peptides but the mechanism of action of only a few have
been elucidated. Those with identified mechanisms can be divided into two categories, those that
enter fungal cells and those that do not. To date, the peptides PsD1, MtDef4, HsAFP1 and NaD1
are the only plant defensins that have been reported to be internalised into cells as part of their
mechanism of action [
12
,
39
–
41
]. NaD1 traverses the cell wall and plasma membrane of F. oxysporum
f.sp. vasinfectum and C. albicans and accumulates in the cytoplasm [
12
,
13
]. In this study, we used
time-course experiments with fluorescently labelled NaD1 to investigate the timing of NaD1 uptake
into C. albicans cells (Figure 1). NaD1 initially accumulated on the cell surface and remained there for
a median time of 4 min (Figure 1B). The first stage of uptake then occurred with an influx of NaD1
together with a small amount of PI, into the periphery of the cytoplasm. After another 0.67 min,
the NaD1 was distributed across the entire cytoplasm and the organelles had started to disintegrate
(Figure 1C). The time delay between attachment of NaD1 to the cell surface and the presence of large
amounts of NaD1 and PI in the cytoplasm may reflect an initial uptake of a relatively small amount of
NaD1. This relatively small amount of NaD1 may then exert its toxic activity on cytoplasmic targets
leading to cell death and membrane permeabilisation and associated influx of NaD1 together with
PI. The variability in uptake timing may be due to a threshold amount of protein required to bind the
cell surface before uptake of the peptide, or membrane permeabilisation, can occur. It is also possible
that cell wall composition changes during the cell cycle may affect the rate of movement of NaD1
through the cell wall. The variability in the timing of NaD1 spread throughout the cytoplasm could
indicate that the mechanism of action is complex and requires many stages of action that could be
subject to delay.
The interesting observations about the timing of NaD1’s uptake into fungal cells, led to the
question of how NaD1 passes through the plasma membrane. Firstly, dependence on energy for uptake
of the peptide and cell killing was investigated using the uncoupler of oxidative phosphorylation,
CCCP. Treatment with CCCP can block endocytic uptake but also disrupts polyamine transporters, as
evidenced by a reduction in uptake of the polyamine spermidine after treatment with CCCP [
21
]. CCCP
also reduces activity and blocks uptake of the human antifungal peptide histatin 5. Mitochondrial
petite mutants are also resistant to histatin 5, confirming the energy dependence of histatin 5
activity [42,43]
. Two distinct mechanisms of uptake have been observed for this peptide. The first
involves translocation of histatin 5 to the cytoplasm by the Dur3p and Dur31p polyamine transporters
in C. albicans [
21
,
42
]. The second involves endocytic uptake and sequestration into the vacuole,
with cells eventually undergoing vacuolar expansion and cell death. However, as deletion of genes
important for endocytosis or treatment with latrunculin A did not make the cells more sensitive to
histatin 5, vacuolar expansion was considered a secondary effect that does not contribute to toxicity [
42
].
This led to the hypothesis that CCCP induced resistance is due to the blockage of energy dependent
uptake through polyamine transporters. In this study, we discovered that uptake of fluorescently
labelled NaD1 into C. albicans cells was also reduced after addition of CCCP (Figure 3). This supported
our earlier work showing that NaD1 activity is reduced against S. cerevisiae rho (petite) mutants with
reduced mitochondrial function [
13
]. Combined, this data indicates that uptake of NaD1 is an energy
dependent process, such as endocytosis or movement through a polyamine transporter and is not due
to passive transport across the membrane.

J. Fungi 2018,4, 20 11 of 15
Polyamine transporters have been tested for a potential role in uptake of NaD1 into S. cerevisiae
cells [
44
]. Deletion of the polyamine transport regulator Agp2, which regulates the expression of
many genes, including the polyamine transporters Dur3 and Sam3 [
45
], reduced the antifungal activity
and uptake of NaD1 and reduced the activity of the antifungal peptides h
β
D2, CP29, BMAP-28 and
Bac2a [
44
]. Furthermore, addition of the polyamine, spermidine, protected S. cerevisiae against NaD1
induced membrane permeabilisation [
44
]. However, deletion of the polyamine transporters themselves
(sam3
∆
, dur3
∆
and sam3
∆
dur3
∆
) did not affect NaD1 activity. Thus it is not likely that NaD1 and the
other cationic peptides are internalised by a polyamine transporter, rather the reduction in spermidine
uptake leads to an accumulation of positively charged polyamines on the surface of yeast cells, which
in turn blocks access of positively charged antimicrobial peptides [
44
]. Given that NaD1 had bound to
the surface of the CCCP treated cells, it is unlikely that the decrease in the activity of NaD1 was due to
an accumulation of surface positive charges in these cells. Instead, the decrease in cell killing is likely
to be directly linked to the reduction in NaD1 uptake and supports the hypothesis that internalisation
of NaD1 into the fungal cytoplasm is an energy dependent process.
To confirm endocytosis as the mechanism of NaD1 uptake in C. albicans, cells were treated with
NaD1 in the presence of the endocytosis inhibitor latrunculin A, or at 4
◦
C which reduces endocytic
uptake. Lowering the treatment temperature to 4
◦
C did decrease NaD1 induced cell death and reduced
uptake of fluorescently labelled NaD1 into the cytoplasm of C. albicans cells (Figure 2). In contrast,
cell death induced by the human antimicrobial peptide LL-37 was not reduced when the temperature
was lowered to 4
◦
C (Figure S1) This is consistent with a report by Ordonez and co-workers (2014),
in which they suggest that LL-37 killing arises from direct membrane permeabilisation and does
not involve endocytosis, because treatment with azide to reduce energy production failed to inhibit
LL-37 activity [
46
,
47
]. Similar to NaD1, the Penicillium antimicrobial peptide PAF also appears to be
internalised by endocytosis, because latrunculin B, which inhibits actin polymerisation like latrunculin
A, blocked PAF internalisation into Aspergillus nidulans hyphae [
18
]. In addition, PAF like NaD1 did
not enter cells in the presence of CCCP and PAF uptake was blocked at 4 ◦C [18].
In another scenario, NaD1 may not be directly internalised by endocytosis but a target of NaD1
on the plasma membrane may require turnover or regulation by endocytosis. This occurs with the
ether-phospholipid edelfosine in S. cerevisiae. Edelfosine is internalised into S. cerevisiae cells but
not through endocytosis and its uptake is not required for toxicity. Instead, edelfosine functions by
inducing endocytic uptake of the plasma membrane H
+
pump Pma1p, which is transported to the
vacuole for degradation. Endocytosis mutants were less susceptible to edelfosine than wild type
cells, even though edelfosine uptake was not affected in these mutants. Instead, blocking endocytosis
had reduced antifungal activity by stopping internalisation of Pma1p [48]. In addition, mutants with
deletions of genes encoding proteins required for protein recycling and transport, including ESCRT
complexes, also enhanced resistance to edelfosine. Uptake and transport of edelfosine to the ER in
these mutants was also not altered and resistance in these mutants was attributed to higher levels of
Pma1p in the membrane due to decreased protein turnover [
48
]. As mutants in the ESCRT pathway
were not resistant to NaD1 (Table 1) it is unlikely that an unknown target protein in the membrane is
responsible for the NaD1 resistance that is generated by treatment with latrunculin A.
Endocytosis may not be the only mechanism by which NaD1 enters into cells. Latrunculin A
did not protect C. albicans from the deleterious effects of NaD1 when NaD1 was at concentrations
higher than 3.5
µ
M in a fungal inhibition assay (Figure 5). However, endocytosis may not have been
completely blocked in cells treated with latrunculin A and a limited amount of endocytosis at high
NaD1 concentrations may have been sufficient to internalise a lethal concentration of NaD1.
Alternatively, NaD1 at high concentrations may have directly damaged the plasma membrane
leading to cell death or transient lipid bilayer disruption which allowed entry of some NaD1 into the
cytoplasm. We have previously reported that NaD1 at high concentrations does partially penetrate
artificial phosphatidylinositol bilayers. Even though the resulting membrane disorder was reversible,
the association of NaD1 with the membrane may have been sufficient to allow small amounts of NaD1

J. Fungi 2018,4, 20 12 of 15
to come into contact with the phosphatidylinositol 4,5 bisphosphate (PI(4,5)P2) on the inner leaflet of
the membrane. Association of even small amounts of NaD1 with PI(4,5)P
2
bilayers results in tight
irreversible binding that produces severe disorder of the membrane and membrane disruption [
16
].
A similar mechanism may occur with histatin 5 at high concentrations. That is, energy depleted
C. albicans cells accumulate high levels of histatin 5 in their cell walls and are killed by histatin 5 via
direct interaction with the membrane [42].
Interestingly, El-Mounadi and co-workers [
15
] have reported that the mechanism of uptake of
the plant defensin MtDef4 varies between fungal species. Entry of MtDef4 into Neurospora crassa
cells is energy dependent and involves endocytosis. Consequently, uptake of MtDef4 into N. crassa is
abolished when ATP production is inhibited by sodium azide. Internalisation of MtDef4 is also reduced
by the endocytosis inhibitor filipin, which blocks lipid-raft mediated endocytosis [
15
]. In contrast,
MtDef4 uptake into Fusarium graminearum is only partially blocked by sodium azide and none of the
tested endocytosis inhibitors affected internalisation of the defensin. Instead, MtDef4 is hypothesised
to be internalised by translocation using a partially energy-dependent mechanism [
15
]. Therefore, it is
possible that uptake of NaD1 could occur through a different mechanism in different fungal species.
It is necessary to expand research into further species to confirm this.
Interestingly, treatment with latrunculin A did not affect MtDef4 uptake into N. crassa. In addition,
uptake ofMtDef4 was affected by brefeldin A [
15
]. These results are in direct contrast to observations
with NaD1 and indicate that these peptides are internalised by different forms of endocytosis. Unlike
MDef4, NaD1 movement through the cell does not appear dependent on the internal endosomal
system, also evidenced by the failure of nocodazole and the deletion of ESCRT components to alter
sensitivity to NaD1 (Figure 6, Table 1). This is consistent with the findings that while MtDef4 most likely
targets the vacuole of N. crassa hyphae [
15
], NaD1 does not appear to associate with any particular
organelle, instead diffusing through the entire cytoplasm [
12
]. It is not known how NaD1 escapes the
endocytic vesicles to access the cytoplasm.
Nonetheless, these observations further expand the model of NaD1’s mechanism of action.
NaD1 traverses the cell wall, accumulates on the cell surface and is then endocytosed through the
plasma membrane into the cytoplasm where it kills the fungal cell, possibly through production of
reactive oxygen species and by membrane disruption following binding of NaD1 to PI(4,5)P
2
on the
inner leaflet.
Supplementary Materials:
The following are available online at www.mdpi.com/2309- 608X/4/1/20/s1, Figure
S1: LL-37 induced cell death was not reduced when the temperature is lowered from 30 ◦C to 4 ◦C.
Acknowledgments:
This work was funded by Australian Research Council grants to MAA (DP160100309) and
MAA and NLV (DP150104386).
Author Contributions:
All authors contributed to the conception and design of experiments as well as data
analysis. Brigitte M. E. Hayes performed the experiments, analysed the data and wrote the manuscript. All authors
contributed to editing the manuscript.
Conflicts of Interest: The authors declare no conflict of interest.
References
1.
Fisher, M.C.; Henk, D.A.; Briggs, C.J.; Brownstein, J.S.; Madoff, L.C.; McCraw, S.L.; Gurr, S.J. Emerging
fungal threats to animal, plant and ecosystem health. Nature 2012,484, 186–194. [CrossRef] [PubMed]
2.
Strange, R.N.; Scott, P.R. Plant disease: A threat to global food security. Annu. Rev. Phytopathol.
2005
,43,
83–116. [CrossRef] [PubMed]
3.
Brown, G.D.; Denning, D.W.; Gow, N.A.R.; Levitz, S.M.; Netea, M.G.; White, T.C. Hidden killers: Human
fungal infections. Sci. Transl. Med. 2012,4, 165rv113. [CrossRef] [PubMed]
4.
Latge, J.P.; Calderone, R. Host-microbe interactions: Fungi invasive human fungal opportunistic infections.
Curr. Opin. Microbiol. 2002,5, 355–358. [CrossRef]
5.
Wanke, B.; Lazéra, M.D.S.; Nucci, M. Fungal infections in the immunocompromised host. Clin. Haematol.
2000,95, 153–158. [CrossRef]

J. Fungi 2018,4, 20 13 of 15
6.
Sanglard, D. Resistance of human fungal pathogens to antifungal drugs. Curr. Opin. Microbiol.
2002
,5,
379–385. [CrossRef]
7.
De Lucca, A.J.; Walsh, T.J. Antifungal peptides: Novel therapeutic compounds against emerging pathogens.
Antimicrob. Agents Chemother. 1999,43, 1–11. [PubMed]
8.
Jenssen, H.; Hamill, P.; Hancock, R.E. Peptide antimicrobial agents. Clin. Microbiol. Rev.
2006
,19, 491–511.
[CrossRef] [PubMed]
9.
Oren, Z.; Shai, Y. Mode of action of linear amphipathic
α
-helical antimicrobial peptides. Pept. Sci.
1998
,47,
451–463. [CrossRef]
10.
Nicolas, P. Multifunctional host defense peptides: Intracellular-targeting antimicrobial peptides. FEBS J.
2009,276, 6483–6496. [CrossRef] [PubMed]
11.
Lay, F.T.; Anderson, M.A. Defensins-Components of the innate immune system in plants. Curr. Protein Pept.
Sci. 2005,6, 85–101. [CrossRef] [PubMed]
12.
Van der Weerden, N.L.; Lay, F.T.; Anderson, M.A. The plant defensin, NaD1, enters the cytoplasm of Fusarium
oxysporum hyphae. J. Biol. Chem. 2008,283, 14445–14452. [CrossRef] [PubMed]
13.
Hayes, B.M.E.; Bleackley, M.R.; Wiltshire, J.L.; Anderson, M.A.; Traven, A.; van der Weerden, N.L.
Identification and mechanism of action of the plant defensin NaD1 as a new member of the antifungal drug
arsenal against Candida albicans.Antimicrob. Agents Chemother. 2013,57, 3667–3675. [CrossRef] [PubMed]
14.
Van der Weerden, N.L.; Hancock, R.E.W.; Anderson, M.A. Permeabilization of fungal hyphae by the plant
defensin NaD1 occurs through a cell wall-dependent process. J. Biol. Chem.
2010
,285, 37513–37520.
[CrossRef] [PubMed]
15.
El-Mounadi, K.; Islam, K.T.; Hernández-Ortiz, P.; Read, N.D.; Shah, D.M. Antifungal mechanisms of a
plant defensin MtDef4 are not conserved between the ascomycete fungi Neurospora crassa and Fusarium
graminearum.Mol. Microbiol. 2016,100, 542–559. [CrossRef] [PubMed]
16. Payne, J.A.E.; Bleackley, M.R.; Lee, T.-H.; Shafee, T.M.A.; Poon, I.K.H.; Hulett, M.D.; Aguilar, M.-I.; van der
Weerden, N.L.; Anderson, M.A. The plant defensin NaD1 introduces membrane disorder through a specific
interaction with the lipid, phosphatidylinositol 4,5 bisphosphate. BBA Biomembr.
2016
,1858, 1099–1109.
[CrossRef] [PubMed]
17.
Heytler, P.G.; Prichard, W.W. A new class of uncoupling agents—Carbonyl cyanide phenylhydrazones.
Biochem. Biophys. Res. Commun. 1962,7, 272–275. [CrossRef]
18.
Oberparleiter, C.; Kaiserer, L.; Haas, H.; Ladurner, P.; Andratsch, M.; Marx, F. Active internalization of the
Penicillium chrysogenum antifungal protein PAF in sensitive Aspergilli. Antimicrob. Agents Chemother.
2003
,
47, 3598–3601. [CrossRef] [PubMed]
19.
Ayscough, K.R.; Stryker, J.; Pokala, N.; Sanders, M.; Crews, P.; Drubin, D.G. High rates of actin filament
turnover in budding yeast and roles for actin in establishment and maintenance of cell polarity revealed
using the actin inhibitor latrunculin-A. J. Cell Biol. 1997,137, 399–416. [CrossRef] [PubMed]
20.
Dutta, D.; Donaldson, J.G. Search for inhibitors of endocytosis: Intended specificity and unintended
consequences. Cell. Logist. 2012,2, 203–208. [CrossRef] [PubMed]
21.
Kumar, R.; Chadha, S.; Saraswat, D.; Bajwa, J.S.; Li, R.A.; Conti, H.R.; Edgerton, M. Histatin 5 uptake
by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins. J. Biol. Chem.
2011
,286,
43748–43758. [CrossRef] [PubMed]
22.
Tati, S.; Jang, W.S.; Li, R.; Kumar, R.; Puri, S.; Edgerton, M. Histatin 5 resistance of Candida glabrata can
be reversed by insertion of Candida albicans polyamine transporter-encoding genes DUR3 and DUR31.
PLoS ONE 2013,8, e61480. [CrossRef] [PubMed]
23.
Deshayes, S.; Morris, M.C.; Divita, G.; Heitz, F. Cell-penetrating peptides: Tools for intracellular delivery of
therapeutics. Cell. Mol. Life Sci. 2005,62, 1839–1849. [CrossRef] [PubMed]
24.
Lindgren, M.E.; Hällbrink, M.M.; Elmquist, A.M.; Langel, U. Passage of cell-penetrating peptides across a
human epithelial cell layer in vitro. Biochem. J. 2004,377, 69–76. [CrossRef] [PubMed]
25. Fungal Genetics Stock Center. Available online: http://www.fgsc.net/.
26.
Davis, D.; Edwards, J.E.; Mitchell, A.P.; Ibrahim, A.S. Candida albicans RIM101 pH response pathway is
required for host-pathogen interactions. Infect. Immun. 2000,68, 5953–5959. [CrossRef] [PubMed]
27.
Davis, D.A.; Bruno, V.M.; Loza, L.; Filler, S.G.; Mitchell, A.P. Candida albicans Mds3p, a conserved regulator
of pH responses and virulence identified through insertional mutagenesis. Genetics
2002
,162, 1573–1581.
[PubMed]

J. Fungi 2018,4, 20 14 of 15
28.
Xu, W.; Smith, F.J.; Subaran, R.; Mitchell, A.P. Multivesicular body-ESCRT components function in pH
response regulation in Saccharomyces cerevisiae and Candida albicans.Mol. Biol. Cell
2004
,15, 5528–5537.
[CrossRef] [PubMed]
29.
Schindelin, J.; Arganda-Carreras, I.; Frise, E.; Kaynig, V.; Longair, M.; Pietzsch, T.; Preibisch, S.; Rueden, C.;
Saalfeld, S.; Schmid, B.; et al. Fiji: An open-source platform for biological-image analysis. Nat. Meth.
2012
,9,
676–682. [CrossRef] [PubMed]
30.
Broekaert, W.F.; Terras, F.R.G.; Cammue, B.P.A.; Vanderleyden, J. An automated quantitative assay for fungal
growth inhibition. FEMS Microbiol. Lett. 1990,69, 55–59. [CrossRef]
31.
Iacopetta, B.J.; Morgan, E.H. The kinetics of transferrin endocytosis and iron uptake from transferrin in
rabbit reticulocytes. J. Biol. Chem. 1983,258, 9108–9115. [PubMed]
32.
Munn, A.L. Molecular requirements for the internalisation step of endocytosis: Insights from yeast. BBA Mol.
Basis Dis. 2001,1535, 236–257. [CrossRef]
33.
Lippincott-Schwartz, J.; Yuan, L.; Tipper, C.; Amherdt, M.; Orci, L.; Klausner, R.D. Brefeldin A’s effects on
endosomes, lysosomes, and the TGN suggest a general mechanism for regulating organelle structure and
membrane traffic. Cell 1991,67, 601–616. [CrossRef]
34.
Wood, S.A.; Park, J.E.; Brown, W.J. Brefeldin A causes a microtubule-mediated fusion of the trans-Golgi
network and early endosomes. Cell 1991,67, 591–600. [CrossRef]
35.
Apodaca, G. Endocytic traffic in polarized epithelial cells: Role of the actin and microtubule cytoskeleton.
Traffic 2001,2, 149–159. [CrossRef] [PubMed]
36.
Matteoni, R.; Kreis, T.E. Translocation and clustering of endosomes and lysosomes depends on microtubules.
J. Biol. Chem. 1987,105, 1253–1265. [CrossRef]
37.
Henne, W.M.; Buchkovich, N.J.; Emr, S.D. The ESCRT pathway. Dev. Cell
2011
,21, 77–91. [CrossRef]
[PubMed]
38.
Saksena, S.; Sun, J.; Chu, T.; Emr, S.D. ESCRTing proteins in the endocytic pathway. Trends Biochem. Sci.
2007
,
32, 561–573. [CrossRef] [PubMed]
39.
Lobo, D.S.; Pereira, I.B.; Fragel-Madeira, L.; Medeiros, L.N.; Cabral, L.M.; Faria, J.; Bellio, M.; Campos, R.C.;
Linden, R.; Kurtenbach, E. Antifungal Pisum sativum defensin 1 interacts with Neurospora crassa cyclin F
related to the cell cycle. Biochemistry 2007,46, 987–996. [CrossRef] [PubMed]
40.
Sagaram, U.S.; El-Mounadi, K.; Buchko, G.W.; Berg, H.R.; Kaur, J.; Pandurangi, R.S.; Smith, T.J.; Shah, D.M.
Structural and functional studies of a phosphatidic acid-binding antifungal plant defensin MtDef4:
Identification of an RGFRRR motif governing fungal cell entry. PLoS ONE
2013
,8, e82485. [CrossRef]
[PubMed]
41.
Cools, T.L.; Vriens, K.; Struyfs, C.; Verbandt, S.; Ramada, M.H.S.; Brand, G.D.; Bloch, C.; Koch, B.; Traven, A.;
Drijfhout, J.W.; et al. The antifungal plant defensin HsAFP1 is a phosphatidic acid-interacting peptide
inducing membrane permeabilization. Front. Microbiol. 2017,8. [CrossRef] [PubMed]
42.
Jang, W.S.; Bajwa, J.S.; Sun, J.N.; Edgerton, M. Salivary histatin 5 internalization by translocation, but
not endocytosis, is required for fungicidal activity in Candida albicans.Mol. Microbiol.
2010
,77, 354–370.
[CrossRef] [PubMed]
43.
Gyurko, C.; Lendenmann, U.; Troxler, R.F.; Oppenheim, F.G. Candida albicans mutants deficient in respiration
are resistant to the small cationic salivary antimicrobial peptide histatin 5. Antimicrob. Agents Chemother.
2000,44, 348–354. [CrossRef] [PubMed]
44.
Bleackley, M.R.; Wiltshire, J.L.; Perrine-Walker, F.; Vasa, S.; Burns, R.L.; van der Weerden, N.L.;
Anderson, M.A. Agp2p, the plasma membrane transregulator of polyamine uptake, regulates the antifungal
activities of the plant defensin NaD1 and other cationic peptides. Antimicrob. Agents Chemother.
2014
,58,
2688–2698. [CrossRef] [PubMed]
45.
Aouida, M.; Texeira, M.R.; Thevelein, J.M.; Poulin, R.; Ramotar, D. Agp2, a member of the yeast amino
acid permease family, positively regulates polyamine transport at the transcriptional level. PLoS ONE
2013
,
8, e65717. [CrossRef]
46.
Ordonez, S.R.; Amarullah, I.H.; Wubbolts, R.W.; Veldhuizen, E.J.A.; Haagsman, H.P. Fungicidal mechanisms
of cathelicidins LL-37 and CATH-2 revealed by live-cell imaging. Antimicrob. Agents Chemother.
2014
,58,
2240–2248. [CrossRef] [PubMed]

J. Fungi 2018,4, 20 15 of 15
47.
Den Hertog, A.; van Marle, J.; van Veen, H.; van’t Hof, W.; Bolscher, J.; Veerman, E.; Nieuw Amerongen, A.
Candidacidal effects of two antimicrobial peptides: Histatin 5 causes small membrane defects, but LL-37
causes massive disruption of the cell membrane. Biochem. J. 2005,388, 689–695. [CrossRef] [PubMed]
48.
Cuesta-Marbán, Á.; Botet, J.; Czyz, O.; Cacharro, L.M.; Gajate, C.; Hornillos, V.; Delgado, J.; Zhang, H.;
Amat-Guerri, F.; Acuña, A.U.; et al. Drug uptake, lipid rafts, and vesicle trafficking modulate resistance to
an anticancer lysophosphatidylcholine analogue in yeast. J. Biol. Chem.
2013
,288, 8405–8418. [CrossRef]
[PubMed]
©
2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access
article distributed under the terms and conditions of the Creative Commons Attribution
(CC BY) license (http://creativecommons.org/licenses/by/4.0/).