Piotr Minkiewicz

Biochemistry, Food Science

30.77

Publications

  • [Show abstract] [Hide abstract]
    ABSTRACT: The presence of specific peptides with antioxidant properties released during carp protein ex vivo and in vitro hydrolysis by human/porcine digestive enzymes, respectively, were examined. Based on the results of the in silico data analysis, antioxidant peptides were selected for subsequent identification in the digests/hydrolysates. Carp proteins were more resistant to hydrolysis by porcine enzymes than by human digestive juices. The sarcoplasmic proteins were hydrolyzed faster than the myofibrillar ones by both human/porcine enzymes. The in vitro myofibrillar protein hydrolysate showed the highest ABTS•+ scavenging activity (~232.3 TEAC, μM Trolox/g), whereas the ex vivo hydrolysate of sarcoplasmic proteins showed the highest DPPH• scavenging activity (~88 μM/g) and reducing power. Five antioxidant peptides were identified in carp protein ex vivo and in vitro hydrolysates: FIKK, HL, IY, PW, VY. The peptide HL from myofibrillar proteins was identified only in the ex vivo hydrolysate, whereas the peptide PW from sarcoplasmic proteins was identified only in the in vitro hydrolysate.
    No preview · Article · Mar 2016 · Food Chemistry
  • Source
    [Show abstract] [Hide abstract]
    ABSTRACT: Bioaktywne peptydy obecne w żywności mogą przyczynić się do zmniejszenia występowania chorób przewlekłych. W produktach spożywczych peptydy zazwyczaj są uwalniane poprzez hydrolizę enzymatyczną białek. W pracy przedstawiono wybrane metody analityczne, chemometryczne i bioinformatyczne, stosowane w badaniach molekularnych i biologicznych właściwości peptydów pochodzących z białek żywności. Opisano także metody zwiększania biodostępności peptydów oraz wybrane aspekty oceny ich bezpieczeństwa. Zrozumienie aspektów molekularnych biologicznej aktywności peptydów stwarza podstawy postępu w wykorzystaniu tych związków jako składników żywności zapobiegających chorobom dietozależnym.
    Full-text · Article · Dec 2015 · Zywnosc: Nauka, Technologia, Jakosc
  • Source

    Full-text · Dataset · Sep 2015
  • Source
    [Show abstract] [Hide abstract]
    ABSTRACT: A common subsequence is a fragment of the amino acid chain that occurs in more than one protein. Common subsequences may be an object of interest for food scientists as biologically active peptides, epitopes, and/or protein markers that are used in comparative proteomics. An individual bioactive fragment, in particular the shortest fragment containing two or three amino acid residues, may occur in many protein sequences. An individual linear epitope may also be present in multiple sequences of precursor proteins. Although recent recommendations for prediction of allergenicity and cross-reactivity include not only sequence identity, but also similarities in secondary and tertiary structures surrounding the common fragment, local sequence identity may be used to screen protein sequence databases for potential allergens in silico. The main weakness of the screening process is that it overlooks allergens and cross-reactivity cases without identical fragments corresponding to linear epitopes. A single peptide may also serve as a marker of a group of allergens that belong to the same family and, possibly, reveal cross-reactivity. This review article discusses the benefits for food scientists that follow from the common subsequences concept.
    Full-text · Article · Sep 2015 · International Journal of Molecular Sciences
  • Source
    [Show abstract] [Hide abstract]
    ABSTRACT: Białka żywności charakteryzują się wieloma właściwościami odżywczymi i biologicznymi. Biologicznie aktywne peptydy to fragmenty sekwencji aminokwasowych białek żywności, które stają się aktywne po uwolnieniu. Zwykle są one uwalniane podczas procesów trawienia, fermentacji (dzięki aktywności proteolitycznej mikroorganizmów) lub procesów enzymatycznych in vitro i wówczas mogą wpływać na zdrowie człowieka. Z białek żywności wyizolowano szereg peptydów bioaktywnych, w tym: inhibitory enzymu konwertującego angiotensynę, antyoksydacyjne, antymikrobiologiczne, antyamnezyjne, opioidowe, sensoryczne czy wiążące mikroelementy. Badane są także peptydy niekorzystnie oddziałujące na zdrowie człowieka, np. toksyczne dla osób chorych na celiakię. Obecnie kontynuowane są badania w celu wskazania nowych źródeł bioaktywnych peptydów, a także sposobów ich otrzymywania, biodostępności, aktywności biologicznej i mechanizmów działania. W artykule przedyskutowano sposoby otrzymywania bioaktywnych peptydów z białek żywności, wybrane rodzaje ich aktywności biologicznej oraz ich biodostępność.
    Full-text · Article · Jul 2015 · Zywnosc: Nauka, Technologia, Jakosc
  • [Show abstract] [Hide abstract]
    ABSTRACT: Bioactive peptides are often studied by applying computer analysis prior to in vitro and in vivo protocols. This has been made possible by progresses in the development of new computer technologies for chemical data processing. The chemical data analysis involves multivariate methods which are the core of chemometrics/cheminformatics. This review presents an overview of the most popular chemometric/cheminformatic methods (i.e. artificial neural networks, principal component analysis, partial least squares and quantitative structure–activity relationship approaches), used to analyze the food-derived bioactive peptides. We also describe other examples of chemometric/cheminformatic analyses like databases of chemical information, pattern similarity and molecular docking. Although, the multivariate analyses of biopeptides may require different chemometric/cheminformatic methods to construct the best predictive models, they become a useful tool in designing novel biopeptides. This tool gives the premise to integrate in silico and experimental protocols in the complex analysis of food-derived bioactive peptides.
    No preview · Article · Jun 2015 · Journal of Functional Foods
  • Piotr Minkiewicz · Anna Iwaniak · Małgorzata Darewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: Internet databases serve as an important source of information on chemical compounds that students can readily investigate, including those studying food science and food technology. This Activity provides a brief introduction to the application of chemical information resources with a focus on conducting structure-based searches.Keywords: Agricultural Chemistry; Bioorganic Chemistry; Chemoinformatics; Computer-Based Learning; Consumer Chemistry; First-Year Undergraduate; Interdisciplinary/Multidisciplinary; Internet/Web-Based Learning; Organic Chemistry
    No preview · Article · Mar 2015 · Journal of chemical education
  • Source
    Piotr Minkiewicz · Jolanta Sokołowska · Małgorzata Darewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: The presence of common epitopes among tropomyosins of invertebrates, including arthropods e.g. edible ones, may help to explain the molecular basis of cross-reactivity between allergens. The work presented is the first survey concerning global distribution of epitopes from Pen a 1.0102 in universal proteome. In the group of known tropomyosin epitopes, the fragment with the sequence ESKIVELEEEL was found in the sequence of channel catfish (Ictalurus punctatus) tropomyosin. To date, this is the first result suggesting the presence of a complete sequential epitope interacting with IgE in vertebrate tropomyosin. Another fragment with the sequence VAALNRRIQL, a major part of the epitope, was found in 11 fish, 8 amphibians, 3 birds, 19 mammalians and 4 human tropomyosin sequences. Identical epitopes are common in sequences of invertebrate tropomyosins, including food and non-food allergens annotated in the Allergome database. The rare pentapeptide with the DEERM sequence occurs in proteins not sharing homology with tropomyosins. Pathogenic microorganisms are the most abundant category of organisms synthesizing such proteins.
    Full-text · Article · Mar 2015 · Polish Journal of Food and Nutrition Sciences
  • [Show abstract] [Hide abstract]
    ABSTRACT: In the digestive tract in humans, bioactive peptides, i.e. protein fragments impacting the physiological activity of the body, may be released during the digestion of food proteins, including those of fish. The aim of the study was to establish the method of human ex vivo digestion of carp muscle tissue and evaluate the angiotensin I-converting enzyme inhibitory and antioxidant activities of hydrolysates obtained after digestion. It was found that the hydrolysates of carp muscle tissue obtained with the three-stage method of simulated ex vivo digestion showed ACE inhibitory as well as antioxidative activities. It was demonstrated that the degree of hydrolysis depended on the duration of individual stages and the degree of comminution of the examined material. Although the applied gastric juices initiated the process of hydrolysis of carp muscle tissue, the duodenal juices caused a rapid increase in the amount of hydrolysed polypeptide bonds. The antihypertensive and antioxidative activities of the hydrolysates of carp muscle tissue increased together with progressive protein degradation. However, the high degree of protein hydrolysis does not favour an increase in the activity of free radical scavenging. The presented results are an example of the first preliminary screening of the potential health-promoting biological activity of carp muscle tissue in an ex vivo study.
    No preview · Article · Jan 2015 · Food & Function
  • Source
    Piotr Minkiewicz · Jolanta Sokołowska · Małgorzata Darewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: Supplement to the publication: The occurrence of sequences identical with epitopes from the allergen Pen a 1.0102 among food and non-food proteins. Piotr Minkiewicz, Jolanta Sokołowska, Małgorzata Darewicz Polish Journal of Food and Nutrition Sciences, 2015, vol. 65, issue 1 DOI: 10.1515/pjfns-2015-0002 List of proteins containing fragments identical with linear epitopes of tropomyosin from Shrimp Farfantepenaeus aztecus (allergen Pen a 1.0102). Journal website: http://journal.pan.olsztyn.pl Article address: http://journal.pan.olsztyn.pl/show.php?id=1410
    Full-text · Dataset · Jan 2015
  • Source

    Full-text · Article · Oct 2014
  • Source
    [Show abstract] [Hide abstract]
    ABSTRACT: http://www.mdpi.com/1422-0067/15/8/14077 The objectives of the present study were two-fold: first, to detect whether salmon protein fractions possess angiotensin I-converting enzyme (ACE) inhibitory properties and whether salmon proteins can release ACE inhibitory peptides during a sequential in vitro hydrolysis (with commercial porcine enzymes) and ex vivo digestion (with human gastrointestinal enzymes). Secondly, to evaluate the ACE inhibitory activity of generated hydrolysates. A two-step ex vivo and in vitro model digestion was performed to simulate the human digestion process. Salmon proteins were degraded more efficiently by porcine enzymes than by human gastrointestinal juices and sarcoplasmic proteins were digested/hydrolyzed more easily than myofibrillar proteins. The ex vivo digested myofibrillar and sarcoplasmic duodenal samples showed IC50 values (concentration required to decrease the ACE activity by 50%) of 1.06 and 2.16 mg/mL, respectively. The in vitro hydrolyzed myofibrillar and sarcoplasmic samples showed IC50 values of 0.91 and 1.04 mg/mL, respectively. Based on the results of in silico studies, it was possible to identify 9 peptides of the ex vivo hydrolysates and 7 peptides of the in vitro hydrolysates of salmon proteins of 11 selected peptides. In both types of salmon hydrolysates, ACE-inhibitory peptides IW, IY, TVY and VW were identified. In the in vitro salmon protein hydrolysates an ACE-inhibitory peptides VPW and VY were also detected, while ACE-inhibitory peptides ALPHA, IVY and IWHHT were identified in the hydrolysates generated with ex vivo digestion. In our studies, we documented ACE inhibitory in vitro effects of salmon protein hydrolysates obtained by human and as well as porcine gastrointestinal enzymes.
    Full-text · Article · Aug 2014 · International Journal of Molecular Sciences
  • Source
    Małgorzata Darewicz · Anna Iwaniak · Piotr Minkiewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: Milk proteins possess a wide range of nutritional and biological properties. They are used as a source of energy, amino acids, vitamins, and minerals which are needed for the growth and development of organisms. Milk proteins contain physiologically active peptides encrypted in the protein sequences. Peptides with biological activity are produced during gastrointestinal digestion or food processing and could play an important role in metabolic regulation and modulation. This suggests the potential use of biopeptides as nutraceuticals and ingredients of functional foods to promote health and reduce the risk of diseases. Milk-derived bioactive peptides were shown to have antihypertensive, antihrombotic, antimicrobial, antioxidative, opioid, mineral-binding properties and anticancer activities. In vitro and in vivo studies are currently being carried out to identify milk bioactive peptides as well as to study their bioavailability and molecular mechanisms of action. Milk as a traditional food product can serve as the example of a functional food and be relevant for health-promoting as well as health-preventing factors. Entire text is in Polish.
    Full-text · Article · Jun 2014 · Medycyna weterynaryjna
  • Anna Iwaniak · Małgorzata Darewicz · Piotr Minkiewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: Nadciśnienie tętnicze jest chorobą cywilizacyjną występującą u pacjentów na całym świecie, szczególnie w krajach o wysokim poziomie rozwoju gospodarczego. Wpływ na występowanie tej choroby ma wiele czynników, takich jak m. in.: wiek pacjenta, predyspozycje genetyczne, styl życia, masa ciała. Dwa ostatnie związane są dietą. Składnikami żywności, które wykazują zdolność obniżania ciśnienia krwi są znajdujące się w sekwencjach białek inhibitory enzymu konwertującego angiotensynę (inhibitory ACE). Niektóre z nich są dostępne na rynku w formie produktów żywnościowych, składników żywności lub suplementów. W pracy scharakteryzowano wybrane inhibitory ACE pochodzące z żywności, których efekt przeciwnadciśnieniowy potwierdzono w badaniach na zwierzętach i/lub ludziach oraz porównano takie peptydy z lekami pełniącymi funkcję inhibitora ACE.
    No preview · Article · Jun 2014 · Lekarz wojskowy
  • [Show abstract] [Hide abstract]
    ABSTRACT: Białka żywności są źródłem peptydów o różnych aktywnościach biologicznych. Mogą m. in. oddziaływać na funkcjonowanie układu krążenia. Do tej grupy biopeptydów można zaliczyć peptydy obniżające ciśnienie krwi (inhibitory enzymu konwertującego angiotensynę - ACE), przeciwkrzepliwe oraz redukujące poziom cholesterolu. Spośród peptydów o wymienionych aktywnościach biologicznych najwięcej z nich pełni funkcję inhibitorów ACE. Niektóre peptydy redukujące ciśnienie krwi stanowią składniki żywności funkcjonalnej oraz nutraceutyków i uzyskały status żywności specjalnego przeznaczenia. Źródłem peptydów przeciwkrzepliwych są głównie białka mleka natomiast obniżających poziom cholesterolu białka soi, ale naukowcy podejmują prace nad poszukiwaniem nowych alternatywnych źródeł peptydów o wymienionych aktywnościach. Należy pamiętać, że chociaż peptydy bioaktywne pochodzące z białek żywności są uznawane za bezpieczne składniki żywności i mogą wspomagać terapię chorób układu krążenia, niemniej nie mogą być traktowane jako zamienniki leków. Niniejszy przegląd przedstawia charakterystykę wybranych peptydów obniżających ciśnienie krwi, poziom cholesterolu oraz peptydów przeciwkrzepliwych, zidentyfikowanych w białkach żywności i badanych z udziałem ludzi lub zwierząt.
    No preview · Article · Jun 2014 · Polski merkuriusz lekarski: organ Polskiego Towarzystwa Lekarskiego
  • Source
    Anna Iwaniak · Piotr Minkiewicz · Małgorzata Darewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: This work is a literature overview on angiotensin-converting enzyme (ACE) inhibitory/antihypertensive peptides in food protein sources. The following aspects related to peptides with the above-mentioned bioactivity are discussed: (i) mechanism of action of ACE, (ii) the structural character of ACE inhibitors/antihypertensive peptide sequences determined by different methods, including quantitative structure–activity relationship studies, (iii) their food sources, (iv) absorption of peptides, (v) in vitro and in vivo approaches involved in the production and potential release of peptide ACE inhibitors as well as in silico methods applied in research concerning peptides.
    Full-text · Article · Feb 2014 · Comprehensive Reviews in Food Science and Food Safety
  • [Show abstract] [Hide abstract]
    ABSTRACT: Według aktualnych poglądów każde białko, oprócz swej podstawowej funkcji, może pełnić rolę prekursora biologicznie aktywnych peptydów. Bioaktywne motywy w łańcuchach białek są definiowane jako te fragmenty, które pozostają nieaktywne w sekwencjach swoich prekursorów, natomiast po uwolnieniu przez enzymy proteolityczne mogą oddziaływać z odpowiednimi receptorami oraz regulować funkcje fizjologiczne organizmu. Peptydy pochodzące z białek żywności mogą wpływać na obniżenie ciśnienia krwi, stymulować działanie układu odpornościowego, hamować proces agregacji płytek krwi oraz procesy utleniania, wykazywać aktywność opioidową, wykazywać aktywność opioidową, antybakteryjną, powierzchniową, wiązać jony metali, kształtować właściwości sensoryczne. Bioaktywne peptydy polecane są jako składniki tzw. żywności funkcjonalnej. Na świecie obserwuje się wzrost zainteresowania tego typu żywnością. W artykule przedstawione przykłady dostępnych komercyjnie produktów zawierających bioaktywne peptydy.
    No preview · Article · Nov 2013
  • [Show abstract] [Hide abstract]
    ABSTRACT: Bioinformatics and cheminformatics tools such as databases play an increasingly important role in modern science. They are commonly used in biological and medical sciences and they have many applications in food science. Databases listing biologically-active compounds contribute to the design of functional foods and nutraceuticals. Databases of toxic or allergenic compounds are useful for food safety evaluations. This review presents examples of freely available databases (without obligatory registration) listing major groups of bioactive components. The main categories of compounds annotated in online databases include: nucleic acids, proteins, peptides, carbohydrates, lipids, and low-molecular weight compounds. Other categories of database entries are also discussed, including enzymes, allergens and their epitopes, flavor-enhancing compounds as well as toxic substances. The last section of the review focuses on metabases, which are websites that create access to multiple databases.
    No preview · Article · Oct 2013 · Food Reviews International
  • Source
    Małgorzata Darewicz · Anna Iwaniak · Piotr Minkiewicz
    [Show abstract] [Hide abstract]
    ABSTRACT: MetaComBio (Meta Compound Bioactivity) is a website containing links to chemical databases describing carbohydrates, flavor and aroma enhancing compounds, haptens, lipids, toxic compounds and other substances important for food quality and safety. MetaComBio provides links to freely available resources.
    Full-text · Dataset · Jun 2013
  • Source
    Marta Dziuba · Piotr Minkiewicz · Marianna Dąbek
    [Show abstract] [Hide abstract]
    ABSTRACT: The objective of this study was to analyse allergenic proteins by identifying their molecular biomarkers for detection in food using bioinformatics tools. The protein and epitope sequences were from BIOPEP database, proteolysis was simulated using BIOPEP program and UniProt database screening via BLAST and FASTA programs. The biomarkers of food proteins were proposed: for example for whey proteins - TPEVDDEALEKFDKALKALPMHIR (β-Lg: fragment 141-164), chicken egg - AAVSVDCSEYPKPDCTAEDRPL (ovomucoid: 156-177), wheat - KCNGTVEQVESIVNTLNAGQIASTDVVEVVVSPPY (triose phosphate isomerase: 12-46) and peanuts - QARQLKNNNPFKFFVPPFQQSPRAVA (arachin: 505-530). The results are annotated in the BIOPEP database of allergenic proteins and epitopes, available at http://www.uwm.edu.pl/biochemia. The epitope-receptor interactions are attributed to the epitope's sequence and suggest that in silico proteolysis products showing the highest degree of sequence identity with an epitope or its part are characteristic of a given protein or a group of cross-reactive homologs. The protein markers from basic food groups were proposed based on the above assumption.
    Full-text · Article · Jan 2013

100 Following View all

109 Followers View all